(data stored in ACNUC30630 zone)

EMBL: BX251410.RPLO

BX251410.RPLO        Location/Qualifiers
FT   CDS_pept        252558..253001
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="TW224"
FT                   /product="50s ribosomal protein L15"
FT                   /note="Similar to Bacillus stearothermophilus 50s ribosomal
FT                   protein L15 RplO SWALL:RL15_BACST (SWALL:P04452) (146 aa)
FT                   fasta scores: E(): 3.1e-15, 44.75% id in 143 aa"
FT                   /db_xref="GOA:Q83I61"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83I61"
FT                   /protein_id="CAD66901.1"
FT                   /translation="MRLIKLHHLRPAPGSRRARIRVGRGEGSKGKTAGRGTKGTKARAP
FT                   VRPGFAGGQIPLHMSIPKLKGFKNHKKVEYSVISIKRLCEAYPSGGVVTRDNVMSVIGK
FT                   KRGFVKLLSDGEVTVKFDITVDKASAAAVEKITSAAGTVTQAR"
     gtgcgtctta ttaaactgca tcacttacgc cctgcacccg gctctcggag agcccgtatt        60
     cgagttggta ggggcgaggg ttctaagggt aagacagctg gccgtggaac taagggaaca       120
     aaggcccgtg cgcccgttag acccggcttt gcaggcggcc agatcccttt gcacatgagc       180
     atcccaaagc taaagggttt caagaatcac aaaaaggttg aatattcggt tatttcaata       240
     aagcgtttgt gtgaagctta tcctagcggc ggtgttgtga ccagggataa tgtgatgtct       300
     gttattggta aaaaaagggg ttttgttaag cttctctcag atggtgaagt gaccgtgaag       360
     tttgatatta ctgttgacaa agcctccgcc gcggccgtgg agaagataac atccgcggcg       420
     ggtacggtaa cccaagcgcg ctaa                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page