(data stored in ACNUC30630 zone)

EMBL: BX251410.RPLP

BX251410.RPLP        Location/Qualifiers
FT   CDS_pept        247898..248329
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="TW214"
FT                   /product="50s ribosomal protein L16"
FT                   /note="Similar to Bacillus subtilis 50s ribosomal protein
FT                   L16 RplP SWALL:RL16_BACSU (SWALL:P14577) (144 aa) fasta
FT                   scores: E(): 2.4e-32, 56.61% id in 136 aa"
FT                   /db_xref="GOA:Q83I71"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83I71"
FT                   /protein_id="CAD66891.1"
FT                   /translation="MMLIPKKVKFRKQHRPNRKGMSGCGTRIVFGDYGIQALSRAYVTN
FT                   RQVESARIAMTRHIRRGGRVWINIYPDRPLTKKPAETRMGSGKGSPEYWVANIRPGRIM
FT                   FEVSGVSESLAKEALMRAIHKLPLRARIVERQEFDDAGL"
     gtgatgctta ttccgaaaaa ggttaaattc agaaagcaac atcgtcccaa cagaaagggc        60
     atgtctgggt gtggcacccg tattgtgttt ggtgattatg gaattcaggc tctttcccgt       120
     gcgtatgtaa ctaatcgtca ggtcgagtct gcgagaattg cgatgactcg tcatattcgc       180
     cgtggtggca gggtttggat aaacatatac cctgataggc ctttgaccaa aaagcccgct       240
     gaaaccagga tggggtcagg gaaaggttct cccgagtact gggttgcgaa tatacgcccc       300
     ggcaggatta tgtttgaggt ttcgggggtt tctgagtcgc ttgcaaaaga ggctttaatg       360
     agggcgattc acaagctgcc cctgcgcgca agaattgttg agaggcagga gtttgatgat       420
     gctgggctct aa                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page