(data stored in ACNUC30630 zone)

EMBL: BX251410.RPLQ

BX251410.RPLQ        Location/Qualifiers
FT   CDS_pept        258010..258549
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="TW233"
FT                   /product="50S ribosomal protein L17"
FT                   /note="Similar to Bacillus stearothermophilus 50s ribosomal
FT                   protein L17 RplQ SWALL:RL17_BACST (SWALL:P07843) (119 aa)
FT                   fasta scores: E(): 3.8e-13, 47.7% id in 109 aa"
FT                   /db_xref="GOA:Q83I55"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83I55"
FT                   /protein_id="CAD66910.1"
FT                   /translation="MPKPSRGPRMCSGPDHERLVLANMSASLFLNKKLRTTEARAKRLR
FT                   PFAEKLVTLSKRGGLHSRRRALSILRNKAALHELFTNIAPLVEDRNGGYTRITKVGFRS
FT                   GDGAPMALIELILEPVSARTRGTDTLPDTVIDTGPDSAPDPVPGSEPGSAAGDLPDADT
FT                   APADPGESSSNQRVIR"
     gtgcctaagc caagcagagg cccgcgtatg tgttcagggc ctgaccatga gcggctcgtt        60
     cttgcgaata tgtctgcctc gctttttctt aacaagaaac tccggacaac tgaggcccgc       120
     gcgaagcgtc ttcgcccctt tgccgagaag ctggtcaccc tctccaagag aggagggttg       180
     cattctcgcc gtcgcgcctt gtcgattttg cgtaataaag ctgctttgca tgagcttttt       240
     accaatattg ctccacttgt tgaggatcgt aacgggggct atactcgcat cactaaagtt       300
     ggttttcgat ccggcgacgg tgctccgatg gcgcttattg aactaattct ggagcccgtt       360
     tccgcacgca cccgcggcac tgatacgctg cctgatactg ttatcgatac aggtcctgat       420
     agtgcgcccg atcccgtccc gggcagtgag ccgggtagcg cagcgggtga tttgcctgat       480
     gccgatactg cacccgcgga ccctggcgaa tcttcttcta accagagagt cattcggtaa       540
//

If you have problems or comments...

PBIL Back to PBIL home page