(data stored in ACNUC30630 zone)

EMBL: BX251410.RPLR

BX251410.RPLR        Location/Qualifiers
FT   CDS_pept        251137..251496
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="TW222"
FT                   /product="50S ribosomal protein L18"
FT                   /note="Similar to Bacillus stearothermophilus 50s ribosomal
FT                   protein L18 RplR SWALL:RL18_BACST (SWALL:P09415) (120 aa)
FT                   fasta scores: E(): 8.7e-20, 52.54% id in 118 aa"
FT                   /db_xref="GOA:Q83I63"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83I63"
FT                   /protein_id="CAD66899.1"
FT                   /translation="MSLTSRASARKRRHVRLRKKISGTCDRPRLSVTRSNRHVFVQAVD
FT                   DISGKTLVSASTMEKDIRALELGKTERALAVGKLVAQRALAVGVKSAVFDRGGCKYTGR
FT                   VAAVAEGAREAGLQT"
     atgagtttga caagtcgtgc ttctgcccgt aagaggcgcc atgtccgctt aaggaaaaag        60
     atttctggca catgtgacag gccccgtctt tctgttacac gctctaacag gcatgttttt       120
     gttcaggctg ttgatgatat atctggtaaa acccttgtga gtgcttcgac tatggagaaa       180
     gatattcgtg ccctcgagct tggcaaaaca gaaagggctt tggctgttgg aaagctagtt       240
     gcccagaggg ctttggctgt tggtgttaaa tctgccgtct ttgaccgtgg tggttgcaag       300
     tacactggta gggttgcggc agttgccgag ggtgctcgag aggcgggttt gcagacgtga       360
//

If you have problems or comments...

PBIL Back to PBIL home page