(data stored in ACNUC30630 zone)

EMBL: BX251410.RPLV

BX251410.RPLV        Location/Qualifiers
FT   CDS_pept        246877..247236
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="TW212"
FT                   /product="50s ribosomal protein l22"
FT                   /note="Similar to Escherichia coli 50s ribosomal protein
FT                   L22 RplV or EryB or b3315 or z4686 or ecs4180 or stm3435 or
FT                   sty4363 SWALL:RL22_ECOLI (SWALL:P02423) (110 aa) fasta
FT                   scores: E(): 2.2e-13, 45.37% id in 108 aa"
FT                   /db_xref="GOA:Q83I73"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83I73"
FT                   /protein_id="CAD66889.1"
FT                   /translation="MSEEKDTPLEAFASLKHSGVTPQKVRRIVDLIRGRSVDEALAILR
FT                   FSPHSASGILYKLIVSAQANYANLLGRDDDLFVSSVYVDEGKTYKRGRPRARGSSSRIL
FT                   KRGSHVTVTLSKEVR"
     gtgagcgaag agaaagatac cccgcttgaa gcctttgcat ctttaaagca ctcgggcgtt        60
     actccgcaga aggttcgcag gattgttgat ctgattcgtg ggcggagtgt tgatgaagcg       120
     ttagcgattt tgcgcttctc tccacattct gccagcggca ttctgtacaa gttaattgtt       180
     tcagcccagg cgaattacgc gaatttgtta ggccgagatg atgacctttt tgtttcttca       240
     gtttatgttg atgagggtaa gacttataag cgtggcaggc ctcgtgctcg tggctcgagc       300
     tcgcgtatcc tcaaacgtgg cagtcatgtg actgttactc tgtccaaaga ggttcggtaa       360
//

If you have problems or comments...

PBIL Back to PBIL home page