(data stored in ACNUC30630 zone)

EMBL: BX251410.RPLX

BX251410.RPLX        Location/Qualifiers
FT   CDS_pept        249284..249625
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="TW218"
FT                   /product="50S ribosomal protein L24"
FT                   /note="Similar to Bacillus stearothermophilus 50s ribosomal
FT                   protein L24 RplX SWALL:RL24_BACST (SWALL:P04455) (103 aa)
FT                   fasta scores: E(): 1.9e-11, 42.85% id in 112 aa"
FT                   /db_xref="GOA:Q83I67"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83I67"
FT                   /protein_id="CAD66895.1"
FT                   /translation="MSVKIRKGDLVQVITGSKTGGKKGKQGRVLAVSGDRVWVEGVNLT
FT                   TRHRKRVTNDKGTSSGGLEKRESPMHISNVALVDPETGAPTKVGFLVKTSGDKTVRVRF
FT                   AKKSGKELT"
     ttgagtgtaa aaataagaaa gggtgacctc gtccaggtta ttacgggatc taaaactggt        60
     ggcaaaaaag ggaaacaggg tcgcgttctt gccgtttcgg gtgaccgggt ctgggttgag       120
     ggtgttaact tgactactcg tcataggaaa cgcgtgacaa atgataaggg cacttcttct       180
     ggtgggcttg aaaaaagaga gtcgcccatg catatttcta atgttgccct tgttgatcct       240
     gaaaccggtg cgccaacgaa ggttggtttt cttgtaaaga cctccggtga taaaactgtt       300
     agggtccgtt ttgctaagaa atctggtaag gagctcacgt ga                          342
//

If you have problems or comments...

PBIL Back to PBIL home page