(data stored in ACNUC30630 zone)

EMBL: BX251410.RPMB

BX251410.RPMB        Location/Qualifiers
FT   CDS_pept        131520..131756
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="TW125"
FT                   /product="50s ribosomal protein L28"
FT                   /note="Similar to Escherichia coli 50s ribosomal protein
FT                   l28 RpmB or b3637 or z5061 or ecs4512 SWALL:RL28_ECOLI
FT                   (SWALL:P02428) (77 aa) fasta scores: E(): 2.9e-10, 51.31%
FT                   id in 76 aa"
FT                   /db_xref="GOA:Q83IB6"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83IB6"
FT                   /protein_id="CAD66805.1"
FT                   /translation="MSSVCQVTGASPGFGYAVSHSHRRTKRRFDPNVRRRTFYVATLGR
FT                   RVTLNVSVKGLRLIDKRGIDAVVRDLIKKGVKL"
     gtgtcctcgg tatgtcaggt aacaggggct tcgcctggtt ttgggtacgc cgtgtcgcac        60
     tcccaccgcc gcactaaacg gcggtttgat ccgaatgtgc gtcgacgcac attttatgtg       120
     gcaacccttg gtaggcgtgt taccctcaat gtatccgtca agggcctcag gttaattgac       180
     aagcgcggta tcgacgcggt tgtgcgtgat cttatcaaaa agggcgttaa gctctaa          237
//

If you have problems or comments...

PBIL Back to PBIL home page