(data stored in ACNUC30630 zone)

EMBL: BX251410.RPMC

BX251410.RPMC        Location/Qualifiers
FT   CDS_pept        248316..248555
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="TW215"
FT                   /product="50s ribosomal protein L29"
FT                   /note="Similar to Escherichia coli 50s ribosomal protein
FT                   L29 RpmC or b3312 or z4683 or ecs4177 SWALL:RL29_ECOLI
FT                   (SWALL:P02429) (63 aa) fasta scores: E(): 0.0011, 40% id in
FT                   60 aa, and to Streptomyces coelicolor 50s ribosomal protein
FT                   L29 RpmC or SCO4710 or SCD31.35 SWALL:RL29_STRCO
FT                   (SWALL:Q9L0D2) (74 aa) fasta scores: E(): 9.1e-12, 54.93%
FT                   id in 71 aa"
FT                   /db_xref="GOA:Q83I70"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83I70"
FT                   /protein_id="CAD66892.1"
FT                   /translation="MLGSKGLSPTDLRGMTDGHLRVELKNAKEEVFKLRFQSATGQLAH
FT                   NARLRAVRRDIARIYTVMRERDIGIRSVQEEVSQ"
     atgctgggct ctaagggttt gtctcccacc gatctgagag gcatgacgga tggtcatttg        60
     cgagttgagc tgaaaaatgc aaaagaagag gtcttcaagc ttcggttcca atctgcaacc       120
     gggcagctcg cgcacaatgc gcgtttgcgt gctgtgcgtc gcgatatagc acggatctat       180
     actgttatgc gtgaaagaga tattggcatt cgaagcgttc aggaagaggt tagtcaatga       240
//

If you have problems or comments...

PBIL Back to PBIL home page