(data stored in ACNUC30630 zone)

EMBL: BX251410.RPMF

BX251410.RPMF        Location/Qualifiers
FT   CDS_pept        236982..237179
FT                   /transl_table=11
FT                   /gene="rpmF"
FT                   /locus_tag="TW198"
FT                   /product="50s ribosomal protein L32"
FT                   /note="Similar to Bacillus stearothermophilus 50s ribosomal
FT                   protein L32 RpmF SWALL:RL32_BACST (SWALL:P07840) (56 aa)
FT                   fasta scores: E(): 4.3, 34.92% id in 63 aa, and to
FT                   Mycobacterium tuberculosis 50s ribosomal protein L32 RpmF
FT                   or Rv0979.1c or mt1007 or mtv044.07c.1 SWALL:RL32_MYCTU
FT                   (SWALL:P58287) (57 aa) fasta scores: E(): 0.00062, 55.1% id
FT                   in 49 aa"
FT                   /db_xref="GOA:Q83I83"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83I83"
FT                   /protein_id="CAD66875.1"
FT                   /translation="MAVPKRKKSRANTRARRSQWKASVPGFARLEERGRPVFYLPHRAR
FT                   RILDSNGNELFMEYKGRRVG"
     gtggctgttc caaaaaggaa gaagtctcgt gctaacactc gcgcccgtcg ctcgcagtgg        60
     aaggcttctg ttcccggttt tgccaggctg gaggagcgcg ggagacctgt tttttacctt       120
     ccgcatcgcg cgcgccgtat tcttgactcc aatggaaatg agctctttat ggaatacaag       180
     ggccgccgcg tcgggtag                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page