(data stored in ACNUC30630 zone)

EMBL: BX251410.RPMJ

BX251410.RPMJ        Location/Qualifiers
FT   CDS_pept        256068..256187
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="TW229"
FT                   /product="50S ribosomal protein L36"
FT                   /note="Similar to Thermus thermophilus 50s ribosomal
FT                   protein L36 RpmJ or Rpl36 SWALL:RL36_THETH (SWALL:P80256)
FT                   (37 aa) fasta scores: E(): 3.8e-10, 70.27% id in 37 aa"
FT                   /db_xref="GOA:Q83I57"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83I57"
FT                   /protein_id="CAD66906.1"
FT                   /translation="MLVKVKPSVKKICGVCKVIRRNGRVAVLCSNPRHKQRQG"
     gtgcttgtga aggtaaagcc tagcgtaaag aagatttgtg gggtctgtaa ggtaattcgc        60
     aggaatggtc gcgttgctgt tttgtgttcg aatcccaggc ataagcagcg gcagggctaa       120
//

If you have problems or comments...

PBIL Back to PBIL home page