(data stored in ACNUC30630 zone)

EMBL: BX251410.RPOA

BX251410.RPOA        Location/Qualifiers
FT   CDS_pept        257011..257994
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="TW232"
FT                   /product="DNA-directed RNA polymerase alpha chain"
FT                   /EC_number="2.7.7.6"
FT                   /note="Similar to Streptomyces coelicolor DNA-directed RNA
FT                   polymerase alpha chain RpoA or SCO4729 or SC6G4.07
FT                   SWALL:RPOA_STRCO (SWALL:P72404) (340 aa) fasta scores: E():
FT                   9.7e-75, 63.91% id in 327 aa"
FT                   /db_xref="GOA:Q820D8"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q820D8"
FT                   /protein_id="CAD66909.1"
FT                   /translation="MLIAHRPTLIEKKVSDIRSRFIIEPLEPGFGYTLGNSLRRTLLSS
FT                   IPGAAVTSINIQGVMHEFSTIPGVKEDVTEIVLNVKRLVISSEIDEPFTVRLYKTGEGE
FT                   VLAKDIEVPTGIEIGNGDLVIATLAKDAVFDMQLTIERGRGYVSAEQNRNDGMSLAGHI
FT                   PVDSIYSPVHKVTYRVEATRAGERTDFDRLIIDVETKPSILPRDAVASAGKTLCELFGL
FT                   ARELNSQAEGVEFGVDSMIPESDEDLRIPIEDLGLSVRSYNCLKREGVNYVSELLGFSE
FT                   QELLDIRNFGQKSADEVQEKLAELGHSLKGSVPGFDGSYFDPNYGS"
     ttgctgattg cccaccgccc gacactgatt gaaaagaaag tttctgatat tcgctcgcga        60
     tttattattg agcctcttga gcctggcttt ggctataccc tgggcaattc gcttcggcgc       120
     acacttctct cttcgattcc gggcgcagcg gtgacatcga taaacatcca gggtgttatg       180
     cacgagttta gcactattcc aggtgttaag gaagatgtaa ccgagattgt tttaaatgtg       240
     aagcgtctgg ttatttcaag tgagattgac gagccgttta ctgtccgtct atataaaacc       300
     ggtgagggtg aggttttggc aaaggacata gaggtgccaa ccggcataga aataggtaat       360
     ggtgatcttg taattgcaac cctcgccaaa gatgcggttt ttgacatgca gcttacaata       420
     gagcgaggca ggggatatgt ttcagcggaa cagaatagaa atgatggaat gtctcttgct       480
     gggcatattc cggtagattc gatctattct cctgttcata aagtaaccta tcgcgttgag       540
     gctacgcgtg ccggtgagag gacggacttt gatcgcctga taatcgatgt cgagactaag       600
     ccttcgattc ttcccagaga tgcagttgca agtgcaggga agactctttg cgagctgttt       660
     ggccttgcac gcgaactgaa ttctcaggcc gagggtgttg agtttggtgt tgattctatg       720
     atcccggaaa gtgatgaaga tctgcgtatt ccgattgagg acttggggct ctcggtaaga       780
     tcctataact gcttgaagcg cgaaggtgta aattatgtca gtgaactcct gggtttttcc       840
     gagcaagagc tcttggatat aagaaatttc ggacagaaat ctgctgatga ggtccaggag       900
     aagttagctg agctgggtca cagccttaag ggaagcgtcc cggggtttga tggctcttac       960
     tttgatccga attatggttc gtag                                              984
//

If you have problems or comments...

PBIL Back to PBIL home page