(data stored in ACNUC30630 zone)

EMBL: BX251410.RPOB

BX251410.RPOB        Location/Qualifiers
FT   CDS_pept        73945..77412
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="TW081"
FT                   /product="DNA-directed RNA polymerase beta chain"
FT                   /EC_number="2.7.7.6"
FT                   /note="Previously sequenced as Tropheryma whipplei
FT                   DNA-directed RNA polymerase beta chain RpoB
FT                   SWALL:RPOB_TROWH (SWALL:Q93GF2) (1216 aa) fasta scores:
FT                   E(): 0, 99.56% id in 1155 aa. Similar to Mycobacterium
FT                   tuberculosis DNA-directed RNA polymerase beta chain RpoB or
FT                   Rv0667 or mt0695 or mtci376.08C SWALL:RPOB_MYCTU
FT                   (SWALL:P47766) (1178 aa) fasta scores: E(): 0, 65.56% id in
FT                   1150 aa"
FT                   /db_xref="GOA:P59642"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/Swiss-Prot:P59642"
FT                   /protein_id="CAD66766.1"
FT                   /translation="MFGVGFLAFAKGKRVCAIGRSSLGKISDPLEVPNLLDLQLDSFDW
FT                   LIGGPRWRAALDAYRKNPSGAPIAEKSGLDEVFDEISPIEDSAGNMQLNFSKPVLEAEE
FT                   LSVRECRVRGRTYSAPLYVEAEFMNHDTGEIKTQTVFMGDFPLMTDKGTFVINGTERVV
FT                   VSQLVRSPGVYFERTPEKNSEKDLFSGRIIPARGAWLEFEVDRHDQLGVRVDRKRRQPV
FT                   IFFLRAIGMTDDEIRDAFGEFESISVQHEKNIGLSRDDALREIYRRVRPGEQASAEAGR
FT                   ALLENFYFTSRRFDLARVGRYKVNRKLGVDVDPTRMVLTRSDIIATIRYLAALHLGFSE
FT                   VAVLNSNKSVPISTDDIDHLGNRRIRPVGELVQNQLRAGLARMERVVRERMTTQDIEAI
FT                   IPQTLINVMPIVAALKEFYGTSQLSQFMDQNNPLAGLTHKRRLSALGPGGLSRERAGVE
FT                   VRDVNPSHYGRMCPIETPEGPNIGLIGSLACYSRVNSFGFIETPYRRVVNGKVTDDIEY
FT                   MTATQEDEHAIAQASTPLRPDNSFVDERVLVRRKGGEVEVVPADQVDYMDVSGRQMVSV
FT                   ATSLIPFLEHNDANRALMGSNMQRQAVPLLVTESPLVGTGMERYVAIDAGDVLIAEDPG
FT                   IVGDVSADVVTVKQDDGKHRDYHVGKFVRSNQGNCYNQRVVVRSGDRVEKGTVLADGPC
FT                   TDKGELSLGRNLLVAFMPWEGYNFEDAIIISQNLVKDDTLSSIHIEEHEVSTRDTKLGS
FT                   EEITRDLPNVSMDYIKDLDERGIIRIGAEVGPGDILVGKVTPKGETELSAEERLLRAIF
FT                   NEKSMEVRDTSLKVPHGQQGTVIDVKLFDAVDGEDKLGAGINQRVVVYIAHKRKITEGD
FT                   KLAGRHGNKGVISKILPVEDMPFMADGTPVDIILNPLGVPARMNFGQVLETHLGWISKQ
FT                   GWKIEGDPDWAKDIRVREAQPDSRVSSPVFDGISEGEITGLFSSVFPNRDGERAVGSDG
FT                   KAILYDGRTGEPFPEPISVGYMYVLKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGG
FT                   QRFGEMEVWALEAYGAAHALQELLTIKSDDVVGRVKVYDAIVKGYPIPTPGVPESFKVI
FT                   VKEMQSLCINIEVVSDGEDDVSADAETLQIEEGLDTSPKVEVGSLEEV"
     ttgtttgggg taggtttttt ggcttttgct aagggtaaaa gggtttgtgc gataggtcgc        60
     tcctctctcg gtaagatctc tgatccgctt gaggttccga accttcttga tttgcagctc       120
     gatagttttg actggctcat aggcggccct aggtggcgcg ccgcccttga tgcttaccgc       180
     aaaaatccgt caggcgcccc aattgccgaa aagagtgggc tggatgaggt gtttgatgag       240
     atatccccca tagaagattc ggctggcaat atgcagctta atttctccaa gccggttctg       300
     gaggccgaag agttgagcgt aagggaatgc cgtgttcgag gcaggaccta ttcggcaccc       360
     ctgtatgttg aggccgagtt catgaatcat gatacgggcg agataaagac tcagacggtt       420
     tttatgggcg atttcccgct tatgactgac aagggtacat tcgtcataaa cggcaccgag       480
     agagttgttg tctctcagct tgttcgcagc cctggtgttt attttgagcg cacgccggaa       540
     aaaaacagtg aaaaggatct tttttcgggc agaataatcc ccgctcgcgg tgcttggcta       600
     gaattcgaag ttgacaggca tgaccagctt ggcgttaggg ttgacaggaa gcgcaggcag       660
     ccggttattt tctttctgag agcaattggc atgactgatg atgagatcag ggatgcattt       720
     ggcgagtttg aatcaataag cgtccagcac gaaaagaata ttgggctgtc cagagatgac       780
     gcgctccggg aaatataccg tcgcgttcgt ccgggggagc aggcatcggc tgaggctggg       840
     cgtgcactct tagagaattt ttactttacc agcagacgtt ttgacctggc aagggttgga       900
     aggtacaaag taaatcgcaa actcggtgtt gatgttgatc caactcggat ggttcttacg       960
     aggtcggata ttatcgcaac aattcgttat ctcgcggcct tgcatctcgg tttctccgag      1020
     gttgcggtgc taaacagcaa caagagtgta ccaatttcaa ccgatgatat tgaccatctt      1080
     ggtaataggc gcattagacc ggttggtgag ttggtgcaaa accagctccg ggctggtctg      1140
     gccagaatgg agcgggttgt gagagagcgc atgacaaccc aggatataga ggcgattatc      1200
     ccgcagacac tcataaatgt catgccaatt gttgcagcgc tgaaggagtt ttatggcacc      1260
     agccagctct cgcagtttat ggatcagaat aacccccttg ccggccttac gcacaagagg      1320
     cgcttgtcag ctcttggccc cggtggactg tcccgcgaac gtgccggtgt tgaggttcga      1380
     gacgtaaatc ccagtcatta cggcaggatg tgtccgatcg aaaccccaga aggtccaaat      1440
     attggcctta tagggtcttt agcgtgctat tccagggtga acagtttcgg ctttatagaa      1500
     accccatata gacgtgttgt caacggaaaa gtcacagacg atattgagta tatgacagca      1560
     acacaggaag atgagcatgc gattgcccag gcaagcactc cgctgcgacc ggacaactcg      1620
     tttgttgatg agcgtgttct ggttcgccga aaaggtggag aggtcgaggt tgtaccggcc      1680
     gatcaggttg attatatgga tgtgtctgga cgtcagatgg tgtctgttgc aacttcgctt      1740
     atacccttcc ttgaacataa tgacgctaac cgtgctctca tgggatcgaa tatgcagaga      1800
     caggctgtac cacttctggt tacggagagt cccctggtcg gcacaggtat ggagcggtat      1860
     gtagcgatcg atgcgggtga tgttttaatt gccgaggatc cgggcattgt gggggatgtt      1920
     tccgctgatg ttgtcactgt caagcaggat gacgggaaac atcgcgacta ccatgttggt      1980
     aaatttgttc gttcaaatca gggcaactgt tacaaccagc gagttgtggt ccgatccgga      2040
     gatcgtgtag aaaaaggtac agttcttgca gatggtccat gtactgacaa aggtgagctt      2100
     agtcttggta gaaatcttct ggttgcgttc atgccctggg agggctataa ctttgaggat      2160
     gcgataatta tcagccagaa tttggtcaag gacgacaccc tttcgtcaat ccacatagaa      2220
     gaacatgagg ttagcacccg ggatacgaag ctgggcagtg aagaaataac acgagacctt      2280
     ccgaatgtaa gcatggatta cataaaggac ttggacgaac ggggtattat ccggattggc      2340
     gctgaggttg gccctgggga cattttggtt ggtaaggtga ccccaaaggg cgagaccgaa      2400
     ctcagcgcgg aagagcgttt gctcagggct atctttaacg agaagagcat ggaggttcgc      2460
     gacacaagtt tgaaggtccc acacgggcag caggggaccg taatcgatgt taagttgttt      2520
     gatgcggttg acggtgaaga taagctgggt gctggcataa atcagcgggt tgttgtgtac      2580
     atagcgcata agcgcaagat tacggaggga gataagcttg ctgggcgcca tggcaacaag      2640
     ggtgttattt caaagatcct tccggtagag gatatgccct tcatggctga tgggaccccc      2700
     gttgatataa tccttaatcc gctcggcgtg cccgcgcgta tgaacttcgg gcaggttttg      2760
     gaaacccatt tggggtggat ctctaagcaa ggatggaaaa tagagggtga tcctgattgg      2820
     gcaaaagata ttcgggtgcg cgaggcgcag cctgatagta gggtttcaag tccggttttt      2880
     gatggaattt ccgaagggga gataaccggg cttttttctt ctgtatttcc aaaccgtgat      2940
     ggtgagcgtg ctgtcggttc tgatggtaag gctattctct atgatggccg cacgggggag      3000
     cccttcccgg aacctatttc cgtcggttac atgtatgtcc taaagttgca ccatctggta      3060
     gacgacaaga ttcatgctcg ctcaacagga ccgtattcga tgataaccca gcaaccgctg      3120
     ggcggcaagg cacaattcgg tgggcagcgc ttcggagaga tggaggtgtg ggcgcttgag      3180
     gcatatggtg cagcgcacgc actccaagag ttgctaacaa taaagtctga tgacgttgtt      3240
     ggccgggtaa aggtatacga tgcgattgtc aagggttatc caattcctac ccccggtgtg      3300
     cctgaatcat ttaaggttat tgtcaaggaa atgcagtctt tgtgcataaa tattgaggtt      3360
     gtttctgacg gtgaggatga tgtttccgct gatgctgaaa ccctacagat agaagaaggt      3420
     ctggatacgt ctcccaaggt agaagttggt tcgcttgaag aggtctag                   3468
//

If you have problems or comments...

PBIL Back to PBIL home page