(data stored in ACNUC30630 zone)

EMBL: BX251410.RPOC

BX251410.RPOC        Location/Qualifiers
FT   CDS_pept        77472..81299
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="TW082"
FT                   /product="DNA-directed RNA polymerase beta' chain"
FT                   /EC_number="2.7.7.6"
FT                   /note="Similar to Aquifex pyrophilus DNA-directed RNA
FT                   polymerase beta' chain RpoC SWALL:RPOC_AQUPY (SWALL:Q9X6Y2)
FT                   (1576 aa) fasta scores: E(): 3.4e-124, 40.11% id in 1573
FT                   aa"
FT                   /db_xref="GOA:Q820D9"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q820D9"
FT                   /protein_id="CAD66767.1"
FT                   /translation="MATTEDIRRWSYGVVKKPETINYRTLKPEKDGLFGEQIFGPTRDW
FT                   ECGCGKYKRSRYRGVVCERCGVEVTQSSVRRERMGHIELAAPVTHIWYFKGVPSRLGYL
FT                   LDIAPKDLDKVIYFAAYMVVSLDEEGRKEDLQDLENELRLDIKQLRDACDASIASAVSE
FT                   LERTITELQDAKTSASRINKVRSEAENKMANIRREYDDKIEHLERVWDSFKALKVGGLY
FT                   AEDDVFRDVQDRYGDYFDACMGAEAIKRRLEDFDLQKTAQELGVQIVECRGQRKVRAIK
FT                   RLRVVNSFITSKANPACMVLDVIPVIPPELRPMVQLDAGRFAASDLNDLYRRVINRNNR
FT                   LKRLLDLGAPRIIVNNEKRMLQEAVDALFDNGRRGRPVSGTNNRTLKSLSDMLKGKSGR
FT                   FRQNLLGKRVDYSGRSVIVVGPTLQLHQCGLPKLMALELFKPFIVKRLLDLALAPNIRS
FT                   ARRMIERGDPAVWDMLDAVIKARPVLLNRAPTLHRLGIQAFEPQLVEGKAIQLHPLVCA
FT                   AFNADFDGDQMAVHLPLSLEAQAEARVLMLASNNILNPSDGRPVTLPSHDMIIGLYHLT
FT                   TVKPSAKGAGRAFSSVAEAIMAKDRGDLSISAPVKILFSNIVLDGKTLDSAVVETTLGR
FT                   AIFNEALPDGHPYINELVDKQVISSIINNLAEVYSKVEVANTLDKIKSVGFHWATRSGV
FT                   TVAISDVVSPPEKQEIISKYETQARGVQQDFEIGLLTDLERRQALVSIWSEATDRVAEA
FT                   MRKCFPDDNTINTMVTSGARGNWLQVRNIAGMRGLVANPKGETIPRPIISSYREGLSVT
FT                   EYFISTHGARKGLVDTALKTADSGYLTRRLVDVAQDVVVRERDCGFTRGVRMPVTFRGD
FT                   DGELHKVENAEHSVYGRTLAEDVKTPDDNLIAKAGEDISGIMIDSFIAAGVESVEVRSV
FT                   LTCRSKVGVCSACYGRSLATGARVDIGDAVGIVAAQSIGEPGTQLTMRTFHSGGSASAV
FT                   DITQGLPRVQELFEARTPRAAAPIAEADGTVSIEDGDRARRLILKSDNNEEFSYTVLKR
FT                   AQLRVKDGSRVSLGDQLVEGSLDPKEVLRVKGIRAVQEYLVNGVQQVYRSQGVPIHNKH
FT                   IEVIVRQMLRKVTVVDHGDTSMLPGELIDQSRYQELNREAQAEGRKTASARQEVTGITK
FT                   ASLATESWLSAASFQETTRVLTQAVISGRRDPLIGLKENVIIGNLIPAGTGLSVYRDVE
FT                   PEPRPEAISRMYPTRRPEIENLLEGDSVDPEFDFSSLTQGLELPDDYPVQ"
     atggccacga ctgaagatat tcgtcgttgg tcatatggcg ttgtaaaaaa gccggagact        60
     ataaactaca gaaccctaaa gcccgagaaa gatggcttgt ttggcgagca gattttcggt       120
     ccgacgcggg attgggagtg tggatgcggt aagtacaagc gcagtcgata cagaggcgtt       180
     gtatgtgaac gctgtggggt tgaagttacc cagtcttccg ttagacgcga gcgtatgggg       240
     catatagagc ttgcggcccc tgtgacccat atctggtatt tcaaaggcgt tccgagtcgg       300
     ttgggttatt tgttggatat tgcgccaaaa gaccttgaca aggttatata cttcgctgct       360
     tatatggttg tttctttgga cgaggaaggt cgcaaggagg atctgcagga tctggagaat       420
     gagcttcgcc tggatataaa gcaattgcgc gatgcttgtg atgcaagtat cgcatccgct       480
     gtttctgaac tcgagagaac aataactgag ctgcaggatg caaagacctc cgcttcccgt       540
     attaacaaag tccgcagtga ggcggagaac aagatggcta atatccgccg tgaatatgac       600
     gataaaatcg aacaccttga gagggtttgg gacagtttca aagctctcaa agttggcggc       660
     ctatatgctg aggatgatgt ttttcgtgat gtgcaagatc gctatggtga ttattttgat       720
     gcatgtatgg gcgcagaggc gattaagcgt cgccttgaag acttcgatct acagaaaaca       780
     gctcaggaac ttggtgttca gattgttgag tgtcgtggcc agcgtaaggt gcgcgccata       840
     aagcgtctta gggttgtcaa ttcgtttatt acctctaagg caaatccagc atgcatggtc       900
     cttgatgtaa tacctgttat tccccctgaa ctgaggccta tggttcagct tgatgctggc       960
     cgatttgccg catctgatct gaatgatctt tatcggcggg ttatcaaccg taacaacaga      1020
     ctaaagagac tcttggatct tggtgcgccg cgtattattg tcaacaatga aaagcgaatg      1080
     ctgcaggagg ctgttgatgc gctttttgac aatggccgcc gtggtagacc agtcagtggg      1140
     actaataaca ggactttaaa atccctttct gacatgctca aaggaaaatc cgggcgattt      1200
     cgtcagaatt tgcttggaaa gcgcgttgat tattcaggtc gttcggttat cgttgttggt      1260
     cctacccttc agctccatca atgcgggttg cccaagctta tggcgctgga attgtttaag      1320
     ccctttattg tcaagcggct tttagatctt gccttagctc ccaatatacg gtctgcgaga      1380
     cggatgattg agcgtggcga tccggctgta tgggatatgc tggatgctgt tataaaggcg      1440
     aggcctgttt tactcaacag ggctccgacc ttgcacaggc tcggtatcca ggcttttgaa      1500
     cctcagctcg ttgaaggcaa agcgattcag ttgcatccgc ttgtgtgtgc tgcttttaat      1560
     gctgattttg atggagacca aatggcggtg cacttaccgc tctctcttga agcccaggcc      1620
     gaggcgcgtg ttttaatgct cgcctcgaat aatatcttga atccttcaga tggtcgaccc      1680
     gtaaccctac cgagtcatga catgatcatt gggttgtatc atctgacaac cgtgaaacct      1740
     tctgctaagg gtgctggtcg cgcattctct tcggtcgccg aggctattat ggcaaaggac      1800
     cggggcgacc tgtcaatcag tgctcctgta aagattcttt tttccaatat tgtattagac      1860
     ggaaaaacgc ttgattcggc agttgttgaa acaactttgg gtcgtgctat tttcaatgaa      1920
     gctctgcccg atgggcaccc ttacatcaat gaattagttg ataagcaagt aatttcgtcg      1980
     attattaata acctggccga ggtctattca aaggtcgagg tggcgaacac tctggacaaa      2040
     ataaagagtg tgggatttca ttgggcgacc cgttctggtg ttactgttgc aatttccgat      2100
     gtcgtgtcac cgcccgaaaa gcaggagata atttctaagt acgagacgca ggccaggggt      2160
     gttcaacagg attttgagat aggccttcta actgacctag aaaggcgaca ggccctggtt      2220
     tccatttggt ctgaggcaac agatcgtgtc gcggaagcga tgcgtaagtg ttttccggac      2280
     gataatacga tcaatactat ggttacttca ggagctaggg gcaactggct tcaagtacgc      2340
     aacattgcgg gtatgcgtgg cttagttgca aacccaaaag gtgagacaat tccgaggcct      2400
     attatttctt cttatcgcga ggggctttct gttaccgagt atttcatttc tacgcacggt      2460
     gctcgtaaag gtcttgttga cactgcccta aaaacggccg attctggtta tctgacaaga      2520
     cgcttggttg acgtggctca ggatgttgtt gttcgcgagc gcgactgcgg ctttacacgg      2580
     ggtgttcgca tgccagttac attccgcggt gatgatggtg aacttcataa ggtggagaat      2640
     gcggaacatt cggtttacgg cagaaccctt gctgaggatg taaaaactcc ggatgacaat      2700
     cttattgcaa aggccggaga agatataagt ggcatcatga tcgacagttt catcgctgcc      2760
     ggtgttgagt ctgttgaagt caggtctgtt ctgacatgtc gatccaaagt tggggtctgc      2820
     tccgcctgct atggtcgctc tcttgcaacg ggtgctcgtg tcgatatagg tgacgcggtt      2880
     ggaattgttg ccgcccagtc cattggtgag cctggcactc agctcacaat gcgtacattc      2940
     cacagtggtg gttcggcatc tgctgttgat atcactcagg gccttcctag ggttcaggag      3000
     ctttttgaag cgagaacacc cagggctgca gctcctattg ccgaggcaga tgggactgtg      3060
     tccattgaag atggtgatag agcgcgccgg cttattctta agtctgataa caacgaagag      3120
     tttagttaca ctgttctaaa gcgcgcgcag ctccgcgtta aagacggcag tcgcgtttca      3180
     ctcggtgatc aattggtcga gggttcattg gatccaaagg aagttttgcg agtcaagggc      3240
     attcgtgcag ttcaggagta cctcgtaaat ggggttcagc aggtgtatcg ctcacagggt      3300
     gttcctattc acaataagca tattgaggtt attgtgcgcc agatgctgcg caaggttacc      3360
     gtcgttgatc acggcgacac gtctatgtta cccggtgaac ttattgatca gtctcgatat      3420
     caggagctaa atcgcgaggc gcaagcggag ggacgtaaaa ccgcttcagc ccgtcaagag      3480
     gttaccggca ttaccaaggc cagcttggct accgagtctt ggttgtccgc cgcctccttc      3540
     caggagacta ctcgtgtttt aactcaggcc gttatttctg gaagaagaga tcctctgatt      3600
     ggcttaaaag agaatgttat tataggaaac cttatcccgg ctggcactgg cttgtccgtc      3660
     tatcgtgatg ttgagccgga gcctagacct gaggctattt cccggatgta cccgactcga      3720
     cgtccagaaa tcgaaaacct tttggaaggt gactctgttg atccagagtt tgatttttct      3780
     tctctaacac aaggccttga attgcccgat gactatcccg tacagtaa                   3828
//

If you have problems or comments...

PBIL Back to PBIL home page