(data stored in ACNUC30630 zone)

EMBL: BX251410.RPSC

BX251410.RPSC        Location/Qualifiers
FT   CDS_pept        247239..247901
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="TW213"
FT                   /product="30s ribosomal protein S3"
FT                   /note="Similar to Escherichia coli 30s ribosomal protein S3
FT                   RpsC or b3314 or z4685 or ecs4179 or stm3434 or sty4364
FT                   SWALL:RS3_ECOLI (SWALL:P02352) (232 aa) fasta scores: E():
FT                   7.2e-36, 50.72% id in 207 aa"
FT                   /db_xref="GOA:Q83I72"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83I72"
FT                   /protein_id="CAD66890.1"
FT                   /translation="MGQKINPYGLRLGITTDHVSHWYSDSTRPGQRYADYVSEDIKIRS
FT                   YLTKTLDRAGIARIEIERTRDRIRVDIYTARPGIVIGRRGAEADRYRLELEKITSKQVQ
FT                   LNILEVKNPETTARLVAQGIAEQLAARVAFRRAMRKGLQSATSAGVRGIRIRLAGRLGG
FT                   AEISRSEFYIEGQVPLQTLRASIDYGFYEARTPYGHIGVKVWIYKKPSVRGRTEGGG"
     atgggacaga agataaatcc gtacggtctg agattgggta taacaacaga ccatgtctcg        60
     cattggtact ctgatagcac aaggccaggt cagcgctatg cagattatgt gtcagaggat       120
     ataaagatac gcagttacct caccaaaacc cttgacagag ctggtattgc gcgcattgaa       180
     atagagagaa cccgcgaccg tataagggtt gacatttaca cagctcgacc gggtatagtt       240
     attggccgcc gaggggctga ggccgatcgg tatcgactcg aattggagaa aataacttcc       300
     aaacaggttc agctgaatat actcgaggta aagaatccag aaacgactgc ccggctcgtt       360
     gcgcagggta ttgcagaaca gctggctgca cgtgttgcgt tcaggcgcgc gatgcgcaag       420
     ggtctgcagt ctgctacatc cgcaggtgtt cgtggtatta ggattcgttt ggctggtcgt       480
     ctcggaggtg ccgagataag ccgttcggag ttctatattg aagggcaggt acctttgcag       540
     acccttcgtg ccagtattga ctacggtttt tacgaagcaa gaactccgta tggtcatatc       600
     ggtgtgaagg tgtggattta caagaagccc agcgttagag gtcgtactga aggtggtggg       660
     tga                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page