(data stored in ACNUC30630 zone)

EMBL: BX251410.RPSE

BX251410.RPSE        Location/Qualifiers
FT   CDS_pept        251493..252353
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="TW223"
FT                   /product="30s ribosomal protein S5"
FT                   /note="Similar to Bacillus stearothermophilus 30s ribosomal
FT                   protein S5 RpsE SWALL:RS5_BACST (SWALL:P02357) (166 aa)
FT                   fasta scores: E(): 5.9e-26, 62.32% id in 146 aa. Has an
FT                   unusually long N-terminal extension relative to homologues
FT                   so may use a downstream alternative translational start
FT                   site."
FT                   /db_xref="GOA:Q83I62"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83I62"
FT                   /protein_id="CAD66900.1"
FT                   /translation="MIHDDDTVDLTDTLADAADSTRSAPDPAPVSDASPRGSSSGADVS
FT                   DAARRQSGTVRQSGNDMVRQSGSELSDQSDTDISADSDTSASQGSARHSARGRHRDSRQ
FT                   KGDSSSRGQFLERVVRINRVAKVVKGGRKFSFSALVVVGDGDGTVGVGYGKAREVPLAI
FT                   SKGIESARKNFFTVPRVASTIPHPVQGEAASGVVLLRPAAPGTGVIAGGPVRAVLECAG
FT                   VRDVLSKSLGSSNSINVVYATLDALKHLEDPASVARRRGLDYYHVVPKRIVRAVNSVGA
FT                   SSDTA"
     gtgatccacg atgatgacac tgttgatcta actgatactt tggctgatgc ggcggattcc        60
     acgcggtctg ctccagaccc cgcgccggta agtgacgcat ccccacgcgg gagttcttcc       120
     ggcgctgatg tttcggatgc cgcacgtcgt caatcgggca cggtaagaca gtctggtaat       180
     gacatggtaa gacagtctgg tagtgaattg tcagatcaat cagatacaga tatcagtgca       240
     gactctgaca cttccgcctc ccaaggctct gctcgtcact ccgctcgtgg gcgtcatcgt       300
     gactcccgtc aaaaaggcga ctcttcttct cgtgggcagt ttttggaacg ggttgtccgg       360
     ataaatcgtg ttgcgaaagt tgtgaagggt ggtagaaagt ttagtttttc cgctctggtt       420
     gttgttggtg atggagacgg gacggttggc gtcgggtacg gcaaagcacg tgaggtgcct       480
     cttgcaattt ctaaaggcat tgaaagtgcg aggaagaatt ttttcaccgt gccgcgtgtt       540
     gcgtcaacta tcccacatcc agttcagggt gaggctgcgt ctggtgttgt tctgttgaga       600
     cctgcggcac ccggcacggg ggttattgcc ggtggtcctg tacgcgccgt tctagaatgt       660
     gccggcgtaa gggatgtgct gagcaagtca cttggttcat cgaatagcat aaatgttgtt       720
     tatgcaacct tggatgcact taaacactta gaggatccgg cttcagtagc ccgacgtaga       780
     ggtcttgact attaccatgt agttcctaaa aggattgtcc gtgcggtgaa tagtgttggg       840
     gctagcagtg acacggctta g                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page