(data stored in ACNUC30630 zone)

EMBL: BX251410.RPSF

BX251410.RPSF        Location/Qualifiers
FT   CDS_pept        complement(126021..126323)
FT                   /transl_table=11
FT                   /gene="rpsF"
FT                   /locus_tag="TW117"
FT                   /product="30s ribosomal protein S6"
FT                   /note="Similar to Streptomyces coelicolor 30s ribosomal
FT                   protein S6 RpsF or SCO3906 or SCH24.28 SWALL:RS6_STRCO
FT                   (SWALL:Q9X8U2) (96 aa) fasta scores: E(): 9.4e-07, 35.86%
FT                   id in 92 aa"
FT                   /db_xref="GOA:Q83IC0"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83IC0"
FT                   /protein_id="CAD66800.1"
FT                   /translation="MLGSPLREYELLVSLGSEFEPEAESRVRSLFTPVEPEGVTVKHLD
FT                   VLGVRKFAYEIKGRNDGVCVVVRLLANAGSIAEIGRQMRLTEDVIRTKLLRVGRK"
     ttgttgggat cccctttgcg tgaatacgaa ctgctggtca gccttgggtc tgaatttgag        60
     cctgaggccg agtctcgtgt tagaagcctc tttactccag tcgaacccga aggggttaca       120
     gtaaagcatc ttgatgttct gggggtacgg aaatttgctt acgagataaa ggggcgcaac       180
     gatggggttt gtgttgttgt caggcttcta gcaaatgccg ggtcgatcgc ggagattggc       240
     aggcagatgc gtctgacaga ggatgttata cgtactaaac ttttgcgagt cggacggaaa       300
     taa                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page