(data stored in ACNUC30630 zone)

EMBL: BX251410.RPSH

BX251410.RPSH        Location/Qualifiers
FT   CDS_pept        250203..250601
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="TW220"
FT                   /product="30S ribosomal protein S8"
FT                   /note="Similar to Bacillus stearothermophilus 30s ribosomal
FT                   protein S8 RpsH SWALL:RS8_BACST (SWALL:P56209) (130 aa)
FT                   fasta scores: E(): 2.1e-25, 57.81% id in 128 aa"
FT                   /db_xref="GOA:Q83I65"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83I65"
FT                   /protein_id="CAD66897.1"
FT                   /translation="MTMTDPLSDMFSRIRNANQVLHKKVTVPSSRLKVSIADLLKREGY
FT                   ILDYSVIDEHPGQLLVIELKYGPDKSRALVGLKRVSKPGLRVYAKSSNLPEVFGGLGIA
FT                   ILSTSSGLLTCSQARKKGVGGEVLAYAW"
     atgactatga cagatccttt gtctgatatg ttttcgcgta tcagaaatgc gaatcaggtt        60
     ctgcataaga aggttactgt tccctcgtcg cgacttaaag tgagcatagc tgatctcctc       120
     aagcgcgagg gctatattct cgactattct gtaattgatg aacatccggg gcagttgctt       180
     gttatagagc ttaaatacgg ccctgataag agcagggcgc ttgttgggct aaaaagggtc       240
     tcgaagcctg ggctgcgtgt ttacgcaaaa tcatctaact tgccggaagt attcggcggg       300
     ctggggattg ctatcctctc tacttcatcg ggcttattga cgtgctctca agccaggaag       360
     aaaggtgtag gcggagaagt tcttgcctac gcgtggtag                              399
//

If you have problems or comments...

PBIL Back to PBIL home page