(data stored in ACNUC30630 zone)

EMBL: BX251410.RPSI

BX251410.RPSI        Location/Qualifiers
FT   CDS_pept        178713..179177
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="TW154"
FT                   /product="30s ribosomal protein S9"
FT                   /note="Similar to Escherichia coli 30s ribosomal protein S9
FT                   RpsI or b3230 or z4588 or ecs4103 SWALL:RS9_ECOLI
FT                   (SWALL:P02363) (129 aa) fasta scores: E(): 2.6e-20, 51.61%
FT                   id in 124 aa, and to Streptomyces coelicolor 30s ribosomal
FT                   protein S9 RpsI or SCO4735 or SC6G4.13 SWALL:RS9_STRCO
FT                   (SWALL:Q53875) (170 aa) fasta scores: E(): 2.4e-25, 61.6%
FT                   id in 125 aa"
FT                   /db_xref="GOA:Q83IA3"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83IA3"
FT                   /protein_id="CAD66834.1"
FT                   /translation="MVPPQRAKNDTSSAPDSAAETRGPLVSSGSGLGRRKSATARVYLS
FT                   PGEGVFVVNGRDINEYFTSKLHRQFACQPLKILDLLGSYDVKVTLHGGGASGQAGAVRL
FT                   GIARALNTIDPENNRKPLKSAGFLTRDSRVKERKKAGLKKARKAPQYSKR"
     atggtacccc cacagagggc aaaaaacgat acctcatctg ccccggactc cgcggcagag        60
     actcgcgggc ctcttgtttc ctccggttcg ggtctggggc gccgtaagag tgcaacagcc       120
     agggtttacc tctctcccgg tgagggtgtc tttgttgtga acggtcgcga tatcaacgag       180
     tattttacga gcaaattgca taggcagttt gcctgtcaac ccctgaaaat tctggactta       240
     ttgggtagct acgatgttaa ggttaccctc cacggcggcg gcgcttccgg acaggctggt       300
     gccgtgcggt tgggcatcgc cagggcactg aacacaatcg accctgagaa taacaggaag       360
     cccctcaagt ctgccggttt tctaacccgt gacagtcggg tgaaagagcg caaaaaagcc       420
     ggcctgaaaa aggcccgcaa ggcacctcag tattcgaagc gttag                       465
//

If you have problems or comments...

PBIL Back to PBIL home page