(data stored in ACNUC30630 zone)

EMBL: BX251410.RPSK

BX251410.RPSK        Location/Qualifiers
FT   CDS_pept        256600..256992
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="TW231"
FT                   /product="30S ribosomal protein S11"
FT                   /note="Similar to Escherichia coli 30s ribosomal protein
FT                   S11 RpsK or b3297 or z4667 or ecs4162 SWALL:RS11_ECOLI
FT                   (SWALL:P02366) (128 aa) fasta scores: E(): 7.1e-26, 56.69%
FT                   id in 127 aa"
FT                   /db_xref="GOA:P66366"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66366"
FT                   /protein_id="CAD66908.1"
FT                   /translation="MSKQAQSRSRKKARKNIPAGLAHIKSTFNNTIVTITDLSGNVIGW
FT                   SSSGAVGFKGSRKSTPYAAQMAADAAARSAQEHGVKKVDVFVKGPGSGRETAIRSLQTA
FT                   GLEIGSISDTTPLAFNGCRPPKKRLV"
     ttgtcaaaac aggctcagag taggtcgcgc aaaaaagcta ggaaaaatat ccctgcaggc        60
     cttgcccata taaagtcaac tttcaataac acgattgtta cgataaccga cctatctggc       120
     aatgtaattg gctggtcatc gagtggtgca gttggcttta aaggatccag aaagtcaaca       180
     ccctatgccg cacagatggc agccgatgct gccgctcgct ctgctcagga gcacggagtg       240
     aagaaagtgg atgtgtttgt aaagggtccg ggttccggca gggagactgc catacggtcc       300
     ctccagacgg caggtcttga gataggctcc ataagcgaca cgacccctct tgcgttcaat       360
     ggatgtcgcc cccctaagaa acgcctggtt taa                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page