(data stored in ACNUC30630 zone)

EMBL: BX251410.RPSM

BX251410.RPSM        Location/Qualifiers
FT   CDS_pept        256222..256596
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="TW230"
FT                   /product="30S ribosomal protein S13"
FT                   /note="Similar to Synechococcus sp. 30s ribosomal protein
FT                   S13 RpsM or Rps13 SWALL:RS13_SYNP6 (SWALL:O24708) (125 aa)
FT                   fasta scores: E(): 6.5e-27, 61.78% id in 123 aa"
FT                   /db_xref="GOA:P66398"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66398"
FT                   /protein_id="CAD66907.1"
FT                   /translation="MARVAGVDIPGNKRVEIGLTYICGIGPTRSRHALTAAGISFDTRV
FT                   KDLTDDQLVALRAHIQNSYRIEGDLRREVASDIRRKVEIGCYQGLRHRRGLPVNGQRTR
FT                   TNARSSKGPRRTVAGKKKAR"
     gtggcgcgcg tagctggcgt tgatattccc ggtaataagc gggttgagat tggcctgaca        60
     tatatctgtg gcataggtcc cacgcgctct cgacatgctc taactgctgc gggtatttca       120
     tttgatacga gagtgaaaga tctgaccgat gatcagttgg ttgccctgcg tgcacacata       180
     cagaatagtt atagaatcga gggtgatctt cgtcgtgagg ttgcttccga catacgtcgt       240
     aaggttgaga ttggctgcta tcagggtttg cgccatcgga ggggtttacc tgttaatggg       300
     cagagaacta gaaccaatgc cagaagcagc aagggccctc gccgcacggt cgctggaaag       360
     aaaaaggcga ggtag                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page