(data stored in ACNUC30630 zone)

EMBL: BX251410.RPSN

BX251410.RPSN        Location/Qualifiers
FT   CDS_pept        131927..132232
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="TW127"
FT                   /product="30s ribosomal protein S14"
FT                   /note="Similar to Escherichia coli 30s ribosomal protein
FT                   S14 RpsN or b3307 or z4677 or ecs4172 SWALL:RS14_ECOLI
FT                   (SWALL:P02370) (100 aa) fasta scores: E(): 5.8e-12, 47% id
FT                   in 100 aa, and to Mycobacterium tuberculosis 30s ribosomal
FT                   protein S14-2 RpsN2 or Rv2056c or mt2117 or mtcy63a.04
FT                   SWALL:R14B_MYCTU (SWALL:O86355) (101 aa) fasta scores: E():
FT                   1.2e-21, 61.38% id in 101 aa"
FT                   /db_xref="GOA:Q83IB4"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83IB4"
FT                   /protein_id="CAD66807.1"
FT                   /translation="MSKLSKIVKNEKRKVIVARYAARRQELKRIIAAPGTAPERRDEAQ
FT                   AALQKLPRDASPVRVRSRDVVDGRPRGILSRFGVSRIRFREMAHRGELPGITKSSW"
     atgtcaaagc ttagcaagat tgtaaagaac gagaagcgca aggttattgt cgcgcggtat        60
     gctgctcgca ggcaggaatt gaagaggatt atcgccgctc cggggacagc ccccgaacgg       120
     cgcgatgagg ctcaggctgc tttgcagaag ctgcctagag atgcgtcacc ggttagggtg       180
     cgctctcgtg atgttgttga tggccgaccc cggggcatcc tcagtaggtt tggcgtctcc       240
     aggattcgtt tccgcgagat ggcgcatcgc ggagaattac ccggtataac caaatcaagc       300
     tggtaa                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page