(data stored in ACNUC30630 zone)

EMBL: BX251410.RPSQ

BX251410.RPSQ        Location/Qualifiers
FT   CDS_pept        248552..248812
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="TW216"
FT                   /product="30S ribosomal protein S17"
FT                   /note="Similar to Escherichia coli 30s ribosomal protein
FT                   S17 RpsQ or NeaA or b3311 or z4681 or ecs4176
FT                   SWALL:RS17_ECOLI (SWALL:P02373) (83 aa) fasta scores: E():
FT                   2.3e-12, 49.35% id in 77 aa"
FT                   /db_xref="GOA:Q83I69"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83I69"
FT                   /protein_id="CAD66893.1"
FT                   /translation="MSQQRGYRKSRRGYVTSNSMDKTIVVKIEDRVKHALYGKVIRKTS
FT                   KVKAHDQGSIAGVGDLVLISETRPISATKRWRLVQILEKAK"
     atgagccagc agcgcgggta ccgcaagtcg cgccgtgggt atgttacgag caacagtatg        60
     gataagacta ttgttgtaaa aatagaggat cgtgtcaaac atgctttgta cggcaaggtg       120
     attcgtaaaa catcaaaggt aaaggcccat gatcagggca gcatagccgg tgtgggtgat       180
     ctggtcctta taagcgagac gaggccgatt agtgctacta agaggtggcg tcttgttcag       240
     atacttgaga aggctaaatg a                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page