(data stored in ACNUC30630 zone)

EMBL: BX251410.RPSR

BX251410.RPSR        Location/Qualifiers
FT   CDS_pept        complement(125191..125442)
FT                   /transl_table=11
FT                   /gene="rpsR"
FT                   /locus_tag="TW115"
FT                   /product="30s ribosomal protein S18"
FT                   /note="Similar to Streptomyces coelicolor 30s ribosomal
FT                   protein S18-2 RpsR2 or SCO3425 or SCE9.32c SWALL:R18B_STRCO
FT                   (SWALL:Q9X8K4) (79 aa) fasta scores: E(): 2.5e-09, 52.77%
FT                   id in 72 aa, and to Escherichia coli, Escherichia coli
FT                   O157:H7 and Salmonella typhi 30s ribosomal protein S18 RpsR
FT                   or b4202 or z5811 or ecs5178 or sty4749 SWALL:RS18_ECOLI
FT                   (SWALL:P02374) (74 aa) fasta scores: E(): 2.1e-05, 43.39%
FT                   id in 53 aa"
FT                   /db_xref="GOA:Q83IC1"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83IC1"
FT                   /protein_id="CAD66798.1"
FT                   /translation="MGYRAKGRRQPKADSVVAPPKRVSIKGLDYKDLASLKRFLSDRGK
FT                   IRARRVTGASIQQQRQIAKAIKNAREMGVIPFKSGVSR"
     atgggatata gagcaaaagg tcgtcgacag cctaaggctg acagtgttgt tgcgccgccg        60
     aaacgcgtga gtatcaaagg tcttgattac aaggatcttg catctctcaa aaggtttttg       120
     tccgacagag gtaagataag ggcgcgcagg gttacagggg cctcaatcca acaacagagg       180
     cagatagcta aggccataaa gaatgccagg gagatgggcg ttataccttt taagagcggt       240
     gtaagcagat ga                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page