(data stored in ACNUC30630 zone)

EMBL: BX251410.RPSS

BX251410.RPSS        Location/Qualifiers
FT   CDS_pept        246596..246877
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="TW211"
FT                   /product="30s ribosomal protein s19"
FT                   /note="Similar to Escherichia coli 30s ribosomal protein
FT                   S19 RpsS or b3316 or z4687 or ecs4181 SWALL:RS19_ECOLI
FT                   (SWALL:P02375) (91 aa) fasta scores: E(): 6.9e-26, 67.39%
FT                   id in 92 aa"
FT                   /db_xref="GOA:Q83I74"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83I74"
FT                   /protein_id="CAD66888.1"
FT                   /translation="MPRSLKKGPFVDMHLLKKVRAGNESKDRNMIKTWSRRSMIIPEML
FT                   GHTIAVHDGRRHIPVFITESMVGHKLGEFAPTRTYRGHVKDDRKARRR"
     gtgccaagaa gtctaaagaa gggcccattt gtcgacatgc atctcttgaa gaaggtgcgg        60
     gctggcaatg agagtaaaga caggaatatg attaagacct ggtcgcgcag atcgatgata       120
     atccctgaga tgctcggtca cacaattgct gttcatgacg gcaggaggca tatccctgtt       180
     tttataacag aatcaatggt tggtcacaaa ttgggcgagt ttgccccgac acggacttat       240
     cgcggtcatg tgaaagatga caggaaggcg cggcgtagat ag                          282
//

If you have problems or comments...

PBIL Back to PBIL home page