(data stored in ACNUC30630 zone)

EMBL: BX251410.SECA

BX251410.SECA        Location/Qualifiers
FT   CDS_pept        149502..152045
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="TW139"
FT                   /product="preprotein translocase SecA subunit"
FT                   /note="Similar to Streptomyces griseus preprotein
FT                   translocase SecA subunit secA SWALL:SECA_STRGR
FT                   (SWALL:P95759) (940 aa) fasta scores: E(): 5.6e-138, 60.32%
FT                   id in 862 aa"
FT                   /db_xref="GOA:Q83NT4"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83NT4"
FT                   /protein_id="CAD66819.1"
FT                   /translation="MSVKLLERILRAGEGRTLKRLRNIAHTVNAIEDEYKGCTDGELRT
FT                   FAFDLKVRHQNGESLDSILPEAFAMVREASSRTLGLRHFDVQIMGGAALHMGYIAEMFT
FT                   GEGKTLVATLPAFLNSLSGNGVHIVTVNDYLAGYHSQQMGRVYKVLGLETGVILADQDP
FT                   STRAQQYRADITYGTNNEFGFDYLRDNMAWSCAERVQRGHNFVILDEVDSILIDEARTP
FT                   LIISGSSSGEVSRWFVEFAGIARALTAGEDYDVDERKHTVGVLEPGIAKVEDLLGISNL
FT                   YESVNTPLISFLNNSIKAKELFKRDRDYVVLDGEVMIVDEHTGRILSGRRYNEGLHQAI
FT                   EAKEGVEIKAENQTLATVTLQNYFRLYKKISGMTGTAVTEASEFMSTYKLPVVSIPTNK
FT                   PNIRKDHPDVVYKNEQIKFENLADHVRECYTRGQPVLIGTTSVEKSEYVSKLLSKRGVR
FT                   HEVLNAKNHAKEARIVAEAGRLRAVTVATNMAGRGTDIILGGNPEVLTAVELRRKGLDP
FT                   SKDPERYEQAWSSAFPKLHRRTREEAEKVIEAGGLMVIGTERHESRRIDNQLRGRSGRQ
FT                   GDPGESRFYLSLTDDLMRKFNPGAASALAARVPDDTAIESKLVSRAIRSAQAQVESLNA
FT                   ETRKNVLKYDDVLNRQRAAIYTDRSRILEGGDIADRVQAFLSDAIEEIINSHAVTAWDF
FT                   DALWADLKTIYPVGISIEELTDEAGGMGRITPDFVMREILSDAKFAYEKRESEIGPESM
FT                   RDLERKVVLSVIDRCWRDHLYEMEYLKEGIGLRAMAQRDPLVEYQKEGFDMFEAMMGRI
FT                   REESIGYLFNIDAQVSSNSPSDARNRPIEHDDNAV"
     ttgtcggtta aattgctcga gaggatcctg cgcgccggcg agggtcgcac cctcaagaga        60
     ttgcgtaata tagcccacac cgtcaatgcc atcgaggacg aatataaagg ctgtacagac       120
     ggtgaactgc gcacttttgc ttttgatctc aaagttcgtc atcagaatgg tgagtccctt       180
     gacagcattc ttccggaagc attcgcaatg gttagagaag cctcgtctcg aacgctgggt       240
     cttaggcatt ttgatgttca gattatgggt ggtgccgcgt tacacatggg gtatattgca       300
     gaaatgttca caggtgaagg taaaactttg gttgcaacgc tcccggcttt tctcaattcc       360
     ctctcgggta acggcgtcca tatagttacg gtgaacgatt accttgctgg atatcactca       420
     cagcaaatgg gcagggtata caaggtattg ggactcgaga ccggggttat tttggctgat       480
     caggatccct caacgcgtgc tcaacaatac agggcggata tcacttatgg aactaataac       540
     gagtttgggt ttgattatct tcgggataac atggcctgga gttgcgccga gagagttcaa       600
     aggggtcata attttgtgat cctcgacgag gtagattcaa ttttgattga tgaggcaagg       660
     actcctctaa ttatctccgg gtcgtcaagt ggtgaagtga gcaggtggtt tgttgagttc       720
     gcgggtattg cacgtgcgct gactgccggt gaggattatg atgttgacga gagaaaacac       780
     acggttggcg ttctcgagcc gggtatagcc aaggttgagg atctgcttgg tataagcaat       840
     ctgtatgagt ctgttaacac ccctcttata tcgtttttga acaactcgat aaaagctaaa       900
     gagcttttca agcgcgatcg cgactatgtc gtgcttgatg gtgaagtgat gatagttgat       960
     gaacataccg gtcgtatttt gagtgggcgt cgttacaatg aggggcttca tcaggcaata      1020
     gaggcaaaag agggcgttga aatcaaggcg gaaaaccaaa cacttgcaac ggttactttg      1080
     caaaattatt ttcgtctcta taaaaaaatc tccggcatga cgggcaccgc agtaacagag      1140
     gcctctgagt tcatgtcgac gtacaaactg cctgttgtgt ccattccgac caataagcca      1200
     aatatacgta aggaccatcc ggatgtcgtc tataagaatg agcagataaa gttcgaaaat      1260
     cttgctgatc atgttcgtga gtgttacact cgtggccagc cagttctgat cggtacaacg      1320
     agtgttgaaa aaagtgaata tgtttcaaaa cttctttcaa agcgtggggt cagacatgag      1380
     gtgttgaacg caaagaatca cgcaaaagag gcccggatag tggcagaggc tggcagactt      1440
     cgtgctgtta ctgttgcaac caatatggct ggcaggggta ctgatatcat ccttggaggt      1500
     aatccagagg tcttgactgc ggtggaattg cgcagaaaag gtcttgatcc atcaaaagac      1560
     cccgaaagat atgaacaggc ttggagttca gcatttccga agctgcatag gagaaccaga      1620
     gaagaggccg aaaaggttat agaagctggt ggccttatgg taattggcac agagcggcat      1680
     gaaagcagaa ggatagataa ccagcttcgc gggaggtcag gcagacaggg tgatccgggt      1740
     gagagtcgtt tctatctttc cctaacagat gatcttatga ggaagtttaa tcccggggcg      1800
     gcatcggccc tcgctgcacg agtgcccgat gacactgcaa ttgagtcaaa attagtcagt      1860
     cgtgcaatac ggtcagctca ggctcaggtt gagagtttaa atgctgaaac tcgcaaaaat      1920
     gtcctcaaat acgacgatgt actaaaccga cagcgtgcgg cgatatacac cgacagaagc      1980
     cgtattctgg aaggcggtga tatagcagac agggtacagg ctttcctttc ggacgcaatt      2040
     gaggaaatca taaacagtca tgcagttacg gcatgggatt ttgacgccct gtgggccgac      2100
     ttgaagacaa tttatcccgt tggcatcagc atagaggaat tgacagatga ggcgggcgga      2160
     atgggcagaa taacaccaga ttttgttatg cgagagattc tgtctgatgc aaaattcgcc      2220
     tatgaaaagc gcgagagcga gataggccct gagtctatgc gtgatcttga gcgcaaggtt      2280
     gttctttccg tgattgatag atgttggcgt gatcatttat acgagatgga atatctgaaa      2340
     gaagggatag gcctccgcgc gatggctcaa agagatcctt tggttgagta tcaaaaggag      2400
     ggctttgata tgtttgaggc aatgatgggg cgaattcgcg aagaaagtat cggttacctg      2460
     tttaatattg atgcccaagt aagctccaac tcaccgagcg atgcaagaaa ccgcccaatt      2520
     gagcatgacg ataatgctgt ctaa                                             2544
//

If you have problems or comments...

PBIL Back to PBIL home page