(data stored in ACNUC30630 zone)

EMBL: BX251410.TIG

BX251410.TIG         Location/Qualifiers
FT   CDS_pept        316355..317668
FT                   /transl_table=11
FT                   /gene="tig"
FT                   /locus_tag="TW281"
FT                   /product="trigger factor"
FT                   /note="Similar to Escherichia coli trigger factor Tig or
FT                   b0436 or z0541 or ecs0490 SWALL:TIG_ECOLI (SWALL:P22257)
FT                   (432 aa) fasta scores: E(): 2.8e-12, 25.55% id in 407 aa,
FT                   and to Streptomyces coelicolor trigger factor Tig or
FT                   SCO2620 or SCC80.05c SWALL:Q9F314 (EMBL:AL442143) (468 aa)
FT                   fasta scores: E(): 6.4e-24, 30.9% id in 453 aa"
FT                   /protein_id="CAD66955.1"
FT                   /translation="MGRTLKSIVQRVSETELKLQVTIPSESLKPHVDRAYREVAKTVSV
FT                   PGFRRGKVPVRIIDQRIGKHVVLDRAINDCIGDFFQSAVDEQGLTPVAAPKAHIASLPT
FT                   EPDASLEVVFDVHVYPDVDFPAFENKQIEVDAIDVTDSMVDSEIVGIREKLATFTALDR
FT                   PAIDGDFLILDLQILDGDKVLSESNAVPYELGSNTLFDGLDSALTSARAGYTTTIDLTP
FT                   PVEDPAGENPQQDQFAKSGDTRRVKLKVSSVNKRDLPEENDELARLVGGFANLEELRKD
FT                   SAKNIERSMLFQRSLQARDLLLEQLLSEITFPLPGPIADVLDEIKDEEEKQNRTKQARR
FT                   DILLDLLAKTFSVTLKEDELERYLSSAAAQRKMSVATLVSVIKSAGQDKYVISDIVRNK
FT                   ALSIALSRVKVIDSAGNPLDISEFTIKTDGDPKVRRSE"
     atgggcagaa ctttgaagag tatcgtacaa agggtcagtg agacagagct gaagctgcag        60
     gtaactattc cctccgaaag cttaaagccc catgtcgaca gggcctatag ggaagttgca       120
     aaaactgtca gtgttccggg tttccgtcgt ggaaaagttc cagtcaggat tattgaccaa       180
     aggattggaa agcatgtagt gctcgatagg gctatcaatg actgcatagg cgattttttc       240
     caatccgcag ttgatgagca gggcctaacc cccgttgcag caccaaaagc gcatatcgct       300
     tctcttccga cagagcccga cgcttcgctt gaagttgtgt ttgatgtgca tgtttatccg       360
     gatgtagatt tcccggcttt tgagaataag cagatagaag ttgatgcaat agatgtcaca       420
     gatagtatgg ttgattctga aatagttggt attcgggaaa agctggcaac ttttactgct       480
     ttagataggc cagctattga tggcgatttt ctgattcttg acttacagat tcttgatggc       540
     gataaagtct taagcgaatc gaatgccgtg ccgtacgagc ttggttccaa tactctgttt       600
     gacggccttg attctgcctt gacctctgcc cgtgcgggtt acaccacaac aatcgatcta       660
     acccctcccg tagaagatcc ggcaggcgaa aaccctcagc aagatcagtt tgctaaaagc       720
     ggggatacaa gacgtgtaaa actgaaagtt tcctctgtca ataaacggga cttgcctgag       780
     gaaaatgatg aacttgcacg tcttgtcggt gggtttgcaa acctcgagga gttaaggaag       840
     gattctgcaa agaatattga gaggtcaatg ctttttcaaa gaagtcttca ggccagggat       900
     ttactgctcg agcaattgct gtcggaaatt acctttcctc ttccaggacc aatagctgat       960
     gtattagacg agattaagga tgaagaggaa aagcaaaaca gaacaaagca agctcgcagg      1020
     gatatattgc ttgatttact tgcaaagact ttttctgtaa ccctcaaaga ggatgaattg      1080
     gagcgatatt tgtcaagtgc cgcagcgcag agaaagatga gtgttgccac acttgtctct      1140
     gtgataaaaa gcgcggggca ggataagtat gttatttctg atattgtccg aaacaaggca      1200
     ctttcaattg cattgagcag agttaaagtg attgactcgg caggaaatcc gttggatatt      1260
     tctgagttta cgattaagac tgatggggat ccgaaggtca ggaggtccga atga            1314
//

If you have problems or comments...

PBIL Back to PBIL home page