(data stored in ACNUC30630 zone)

EMBL: BX251410.TRUA

BX251410.TRUA        Location/Qualifiers
FT   CDS_pept        258575..259378
FT                   /transl_table=11
FT                   /gene="truA"
FT                   /locus_tag="TW234"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="4.2.1.70"
FT                   /note="Similar to Escherichia coli tRNA pseudouridine
FT                   synthase A TruA or HisT or AsuC or LeuK or b2318
FT                   SWALL:TRUA_ECOLI (SWALL:P07649) (270 aa) fasta scores: E():
FT                   5.1e-18, 32.27% id in 251 aa, and to Streptomyces
FT                   coelicolor tRNA pseudouridine synthase A TruA or SCO4731 or
FT                   SC6G4.09 SWALL:TRUA_STRCO (SWALL:O86776) (284 aa) fasta
FT                   scores: E(): 4.5e-34, 40.59% id in 271 aa"
FT                   /db_xref="GOA:Q820Z2"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q820Z2"
FT                   /protein_id="CAD66911.1"
FT                   /translation="MNKTRYRLDVAYDGANFCGWAPQPGLRTVGGLILDALRLICSEPP
FT                   DIVIAARTDAGVHALQQVCHVDLISSPDPVWLLHRLRSLLKSETDLHILSAVKAPVNFH
FT                   ARFSAIGRRYVYRVIDKRSSWYPQNRYFVYRVNAFLQDYRMRRAASGLIGLKDFGAFCK
FT                   PRRMGSTVRHLRQFEVIRQPDGQIHFFLESDAFCHSMVRNLVGSLIEVGRGALTLQDLF
FT                   CYTKIAKRTPKIPTLPPHALTLIGIDYPQEHLFECQNRKTRQKRT"
     gtgaataaga cccgatatcg tcttgatgtt gcatatgatg gagcgaattt ttgtggttgg        60
     gcaccgcagc ccgggcttag gaccgtcggt ggtctcattc ttgatgcttt acgccttatc       120
     tgcagcgaac cgcccgacat tgtcatagcg gcaagaacag atgctggtgt tcacgcccta       180
     caacaagtgt gtcatgttga ccttatttca tcaccagacc ctgtttggct tttgcacaga       240
     ctccgctctc tactgaaatc cgagaccgac cttcatatcc tttctgctgt caaggcaccg       300
     gtgaattttc acgctcgttt ctcagcaata ggcagaagat atgtttaccg tgtcattgac       360
     aagcgctctt cgtggtatcc ccagaataga tattttgttt acagagtaaa tgcttttttg       420
     caagattatc ggatgcgcag ggcagcttct ggccttattg ggctaaagga ttttggtgct       480
     ttttgcaagc cgcgtcgcat gggaagtaca gtacgtcatc taaggcaatt tgaagttatt       540
     aggcagccag atggacagat acatttcttt ctcgaatcag atgctttttg tcactctatg       600
     gtcagaaact tagtgggcag cttgatagaa gtgggtcgtg gggcacttac attacaagat       660
     ctgttttgct ataccaaaat tgcgaagaga acgccaaaaa ttcctaccct gccgccccat       720
     gcactcactt tgattggcat tgactatccg caggaacatc tttttgagtg tcaaaacaga       780
     aaaacccgac agaagcgcac ttga                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page