(data stored in ACNUC30630 zone)

EMBL: BX251410.TRUB

BX251410.TRUB        Location/Qualifiers
FT   CDS_pept        complement(96582..97733)
FT                   /transl_table=11
FT                   /gene="truB"
FT                   /locus_tag="TW097"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /EC_number="4.2.1.70"
FT                   /note="Similar to Escherichia coli and Escherichia coli
FT                   O157:H7 tRNA pseudouridine synthase B TruB or p35 or b3166
FT                   or z4527 or ecs4047 SWALL:TRUB_ECOLI (SWALL:P09171) (314
FT                   aa) fasta scores: E(): 2.2e-23, 35.24% id in 227 aa"
FT                   /db_xref="GOA:Q820Z5"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q820Z5"
FT                   /protein_id="CAD66781.1"
FT                   /translation="MLGKVERSEMYILFAMTQVLLVDKISGITSHTAVAKIRHLTGVKK
FT                   IGHCGTLDPAACGLLIMGCGTATRLIRYMSNLDKRYIATITLGTQTTTDDSEGEIIYSA
FT                   PKPSLDKITLESIGRAAEKLSGTIKQIPSAYSAIKVSGNRAYNLARQGIIPKLNAREVR
FT                   VHWKFLGDFENNQVHVQITCSSGTYVRALARDMGKFLGVGGHLSYLKRLSIGPFHLHEI
FT                   YREINKKEATMSERTPSGNTQGLTDNMAISDNMAISESDKHDCTEPGINCTELGIKDTC
FT                   TALREVHYTQGDTLSFTRLTALQALSRIYKPIEVSQKQADDLSCGRYISLGIDSNGPVC
FT                   AVCKENLIAVIQPVSAGLWRPETVLSDNRKLNSNAAQDASGST"
     atgttaggta aagttgaacg ttctgagatg tatatactgt tcgctatgac gcaggttctt        60
     ctggtagaca aaataagcgg cattacaagt cacacagctg ttgcaaaaat aaggcacctc       120
     acaggagtaa aaaaaatcgg gcattgcgga accctcgatc cggcagcgtg tggtcttttg       180
     ataatgggat gcggaactgc aacaagactt ataagatata tgtccaatct tgataagcgg       240
     tatattgcaa caataacgct gggcacacaa acaacaactg atgattcaga aggtgagatt       300
     atatacagtg caccaaagcc atcccttgac aaaattacac tcgagagcat agggagggct       360
     gcggagaaat taagcggaac aatcaaacaa atcccgagcg catacagcgc aataaaggtc       420
     tctggaaata gagcgtacaa cctagcgcgt caggggatta tcccaaagct caatgcacga       480
     gaggtgcggg tgcattggaa atttctcgga gattttgaaa ataaccaagt tcatgtgcag       540
     attacctgtt catctggtac atacgttagg gcattggccc gggatatggg aaaattcctg       600
     ggtgttggcg ggcacttatc atacctaaaa cgcctcagca tagggccatt tcatttgcat       660
     gaaatatatc gggaaataaa caaaaaggaa gccaccatgt ctgagcgaac gcctagtggt       720
     aatacgcaag gattaactga caacatggcc atctccgaca acatggccat ctccgagagt       780
     gataagcacg attgtactga gcctggaatt aattgtactg agcttggaat taaagataca       840
     tgcacagcgc ttcgtgaagt gcactataca caaggtgata cactgtcatt cactcgcctc       900
     acagccctcc aggcattatc aagaatttac aaaccgatag aagttagtca aaaacaggca       960
     gatgacctaa gttgcgggcg atatatatct cttggaatcg actcaaacgg cccggtgtgt      1020
     gcagtttgta aagaaaattt aattgcggtt attcagccgg tatcagcagg attatggcgc      1080
     cctgaaacag ttctcagtga taacagaaaa ctcaacagta atgcggcaca agacgcaagt      1140
     ggaagcacat aa                                                          1152
//

If you have problems or comments...

PBIL Back to PBIL home page