(data stored in ACNUC30630 zone)

EMBL: BX251410.TUFA

BX251410.TUFA        Location/Qualifiers
FT   CDS_pept        136972..138165
FT                   /transl_table=11
FT                   /gene="tufA"
FT                   /locus_tag="TW131"
FT                   /product="elongation factor TU-1"
FT                   /note="Similar to Escherichia coli elongation factor TU
FT                   (TufA or b3339) and (TufB or b3980) SWALL:EFTU_ECOLI
FT                   (SWALL:P02990) (393 aa) fasta scores: E(): 1.1e-103, 70.38%
FT                   id in 395 aa, and to Micrococcus luteus elongation factor
FT                   TU Tuf or TufA SWALL:EFTU_MICLU (SWALL:P09953) (396 aa)
FT                   fasta scores: E(): 6.3e-119, 82.02% id in 395 aa"
FT                   /db_xref="GOA:Q83NT9"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83NT9"
FT                   /protein_id="CAD66811.1"
FT                   /translation="MAKAKFERTKPHVNIGTIGHVDHGKTTLTAAISRVLSERLPSNTN
FT                   VKQDFDAIDSAPEERQRGITINISHIEYETEKRHYAHVDAPGHADYIKNMITGAAQMDG
FT                   AILVVAATDGAMAQTREHVLLAKQVGVPYLLVALNKADMVSDEEILELVELEVRELLST
FT                   HGFDGENVPVVRVSGLKALEGDQKWGDAVMELMKAVDESIPDPVRDRDKPFLMPIEDVF
FT                   TITGRGTVVTGRAERGVLAVNSEVEIVGIRPTQKTTVTGIEMFRKQLDEAWAGENCGLL
FT                   LRGTKREDVERGQVVVKPGSVTPHTKFEGKAYILSKDEGGRHNPFYSNYRPQFYFRTTD
FT                   VTGVITLPEGTEMVMPGDTISITVDLIQPIAMEEGLGFAIREGGRTVGAGTVVKILE"
     atggcaaagg ccaagtttga gcggactaaa ccccatgtga atattgggac tataggtcat        60
     gttgaccacg gtaaaaccac actgaccgcc gccatatcga gggttttgtc cgagaggctt       120
     ccttcgaata cgaatgtaaa gcaggacttt gatgcaattg actcggcccc ggaagagcgc       180
     cagaggggta ttacgatcaa tatttcgcat atcgagtacg agacggaaaa gaggcactac       240
     gcccatgttg atgccccagg acatgccgat tacataaaga atatgattac tggcgccgct       300
     cagatggatg gtgcgattct tgttgttgcg gcgacagacg gtgcaatggc ccagacccgt       360
     gagcatgtct tgcttgccaa gcaggtcggc gtcccctatc tccttgtggc actcaataaa       420
     gccgatatgg tgtctgatga ggaaatactc gagcttgttg agcttgaggt gcgcgagctg       480
     ttgtcaactc acggctttga cggtgagaat gttcccgttg tacgcgtatc tggccttaaa       540
     gcacttgaag gtgatcaaaa gtggggcgat gcggttatgg agcttatgaa agccgttgat       600
     gagagcattc cggaccccgt tagagatagg gataaaccct ttttgatgcc cattgaggat       660
     gtgttcacaa tcactgggcg cggaacggtt gttacaggcc gtgcagagcg tggtgttctt       720
     gcggttaatt ccgaggttga aatagtcggt atacgcccga cgcagaaaac cactgtaacg       780
     ggaattgaaa tgtttcgcaa gcagttggat gaggcgtggg caggtgagaa ctgcggcctg       840
     ctgcttcgcg gcacaaaacg ggaagatgtc gagcgtgggc aggttgttgt gaaacctggc       900
     agtgttacac cgcatacaaa gtttgaggga aaggcgtata ttctgtcgaa agatgagggt       960
     ggaaggcata acccgttcta tagtaactat cgcccacagt tttacttcag gacaactgac      1020
     gtgactggcg ttataaccct tcctgaggga acagaaatgg ttatgcccgg cgataccatc      1080
     tctataacag tcgacttgat tcagccaatt gctatggaag aaggcttggg ttttgcgatt      1140
     cgcgagggtg gcagaactgt tggcgcaggc actgtagtga aaattcttga atag            1194
//

If you have problems or comments...

PBIL Back to PBIL home page