(data stored in ACNUC30630 zone)

EMBL: BX251410.UNG

BX251410.UNG         Location/Qualifiers
FT   CDS_pept        221086..221778
FT                   /transl_table=11
FT                   /gene="ung"
FT                   /locus_tag="TW179"
FT                   /product="uracil DNA glycosylase"
FT                   /note="Similar to Streptomyces coelicolor uracil DNA
FT                   glycosylase Ung or SCO1114 or 2SCG38.07 SWALL:Q9EX12
FT                   (EMBL:AL445503) (225 aa) fasta scores: E(): 2.6e-52, 59.17%
FT                   id in 218 aa, and to Homo sapiens uracil-DNA glycosylase,
FT                   mitochondrial precursor Ung or Dgu or Ung15 SWALL:UNG_HUMAN
FT                   (SWALL:P13051) (304 aa) fasta scores: E(): 6.1e-26, 42.18%
FT                   id in 192 aa"
FT                   /db_xref="GOA:P67079"
FT                   /db_xref="InterPro:IPR002043"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR018085"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67079"
FT                   /protein_id="CAD66858.1"
FT                   /translation="MGYLHVLAQRGVIHATWVSALEPVSSNLAAMGDCLRSLRSKGESF
FT                   LPAPRNILRAFRYPFDSVRVLIVGQDPYPTQGHPIGLSFAVDHKVRPLPGSLQNIYTEY
FT                   RSDLNLDPPQHGDISLWSERGVMLLNRTLTVRPGIPSSHRGLGWEEITQTAVRALAARD
FT                   VPLIAILWGRHAQELKSVLQSDRVAILESVHPSPMSATRGFFGSKPFSKANDLLRDLGS
FT                   APIDWRLT"
     atgggctatc ttcatgtttt ggcgcaacgt ggcgttattc atgcgacatg ggtttctgct        60
     ctggagccgg tttcatccaa tctcgccgca atgggggatt gcttgcggtc gcttcgctca       120
     aagggtgagt cattcttacc ggcaccgcgt aatattctca gggcttttcg ctatccattc       180
     gactctgtaa gggttcttat agttggccag gatccgtatc caacccaagg gcatccaatt       240
     ggtcttagct ttgctgtcga tcataaggtg cgtccgcttc ccggcagtct gcaaaatata       300
     tacactgagt atcgaagtga tttgaacctt gatccgccac agcacggtga tataagtctt       360
     tggtcggaac gcggtgttat gctcttgaac aggactttaa cggtccgccc gggcataccc       420
     tcaagtcaca gaggtcttgg atgggaagag attacgcaga ctgccgttag agctcttgcg       480
     gcccgcgatg ttccgctgat tgcgattttg tggggcaggc atgcacagga gcttaagtct       540
     gttctacaga gtgacagggt tgccatactc gaatctgttc atccaagtcc tatgtcggcc       600
     acgaggggct ttttcggatc aaagcctttc agtaaagcaa atgacctttt acgagacctt       660
     ggttccgctc caattgattg gcgtcttacc taa                                    693
//

If you have problems or comments...

PBIL Back to PBIL home page