(data stored in ACNUC1104 zone)

EMBL: BX640427.CHER

BX640427.CHER        Location/Qualifiers
FT   CDS_pept        188461..189321
FT                   /transl_table=11
FT                   /gene="cheR"
FT                   /gene_synonym="cheX"
FT                   /locus_tag="BPP1475"
FT                   /product="chemotaxis protein methyltransferase"
FT                   /EC_number="2.1.1.80"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1031"
FT                   /db_xref="GOA:Q7WAA5"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR026024"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036804"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAA5"
FT                   /protein_id="CAE36777.1"
FT                   /translation="MATAMTTPAFSAERQFEFRDADFARVRQMIYARAGISLGAHKREM
FT                   VYSRLARRLRALGQQEFRVYLDGLENEPAAPEWEDFVNALTTNLTAFFRESHHFPILAD
FT                   FARQRGGPVSVWCCAASTGEEPYSIAMTLVESLGARAQASQLLATDIDTNCLQRARAGV
FT                   YPYERVAKLDPARLKRFFMRGRGANEGQVKVRAELADMVRFETLNLLAPHWPINEKFDA
FT                   IFCRNVMIYFDKPTQARILRRFVPLLKPGGLLFAGHSENFTYISRDFRLRGQTVYEQAS
FT                   GELPV"
     gtggcgacag caatgacgac gccggctttc agcgccgagc gccagttcga gttccgcgac        60
     gcggacttcg cccgggtacg gcagatgatc tacgcgcgcg ccggcatttc gctgggcgcg       120
     cacaagcgcg agatggtgta cagccgcctg gcgcggcgcc tgcgcgcgct ggggcagcag       180
     gagttccgcg tctacctgga cgggctggag aacgagccgg ccgcgcccga gtgggaagac       240
     ttcgtcaacg ccctgacgac caacctgacc gccttctttc gcgagtcgca tcactttccc       300
     attctggccg atttcgcgcg ccagcgcggc gggccggtat cggtgtggtg ctgcgccgcc       360
     tcgaccggcg aggagccgta ctcgatcgcc atgacgctgg tcgagagcct gggcgcgcgc       420
     gcccaggcca gccagctgct ggccaccgat atcgacacca actgcctgca gcgcgcgcgc       480
     gcgggcgtct atccgtacga gcgggtggcc aagctggacc cggcgcgcct gaagcgcttc       540
     ttcatgcgcg gacgcggcgc caatgagggg caggtcaagg tgcgcgcgga gctggccgac       600
     atggtgcgct tcgagacctt gaacctgctg gcgccgcact ggccgatcaa cgagaagttc       660
     gacgcgatct tctgccgcaa tgtcatgatt tacttcgaca agccgaccca ggccaggatc       720
     ctgcggcggt tcgtcccctt gctcaagccg ggcgggctgc tgtttgccgg gcattccgag       780
     aatttcacct atatcagccg cgacttccgc ctgcgcggac agactgtcta tgagcaggcc       840
     agcggcgagt tgccagtatg a                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page