(data stored in ACNUC1104 zone)

EMBL: BX640427.FLGC

BX640427.FLGC        Location/Qualifiers
FT   CDS_pept        199558..199977
FT                   /transl_table=11
FT                   /gene="flgC"
FT                   /gene_synonym="flaW"
FT                   /gene_synonym="fla FIII"
FT                   /locus_tag="BPP1486"
FT                   /product="flagellar basal-body rod protein FlgC"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1374"
FT                   /db_xref="GOA:Q7WA96"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006299"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA96"
FT                   /protein_id="CAE36788.1"
FT                   /translation="MSLLSIFEIAGSALSAQSQRMNVSASNMANADSVAGPDGQPYRAR
FT                   QVVFQVNPPPGQAFGQEIGGVRVAGVVEDQSPFKKIYDPKHPMADAQGYVNMPNVDPVA
FT                   ETVNMIAASRSYQANVEVLNTAKQLMLKTLTIGQS"
     atgtccctgt tgagcatttt cgagatcgcc ggttcggcgc tgagcgcgca gtcccagcgc        60
     atgaacgtgt cggccagcaa catggccaac gccgacagcg tggccggccc cgacggccag       120
     ccgtaccggg cgcgccaggt ggtgttccag gtcaatccgc cgcccggcca ggccttcggc       180
     caggagatcg gcggcgtgcg cgtggccggc gtggtcgagg accagtcgcc cttcaagaaa       240
     atctacgacc ccaagcatcc gatggccgac gcacagggct acgtgaacat gcccaacgtc       300
     gatccggtgg ccgagacggt caacatgatc gccgcctcgc gctcgtacca ggccaacgtc       360
     gaagtgctca acaccgccaa gcagctgatg ctcaagacgc tgaccatcgg ccagtcctga       420
//

If you have problems or comments...

PBIL Back to PBIL home page