(data stored in ACNUC1104 zone)

EMBL: BX640427.FLGD

BX640427.FLGD        Location/Qualifiers
FT   CDS_pept        200025..200729
FT                   /transl_table=11
FT                   /gene="flgD"
FT                   /gene_synonym="flaV"
FT                   /gene_synonym="fla FIV"
FT                   /locus_tag="BPP1487"
FT                   /product="basal-body rod modification protein FlgD"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1375"
FT                   /db_xref="GOA:Q7WA95"
FT                   /db_xref="InterPro:IPR005648"
FT                   /db_xref="InterPro:IPR025963"
FT                   /db_xref="InterPro:IPR025965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA95"
FT                   /protein_id="CAE36789.1"
FT                   /translation="MTTVNETTSQAGLALAQAGSNSAAQGIQDQFLTLLVTQLRNQDPL
FT                   NPMENAELTSQLAQISTVEGINNLKNTMLAISGQIDVSQSMDAVSMIGKGVLMPGDKVS
FT                   LGTDPNDPAQRGATPFGIDLQGDATKVTVKVLDPSGAVVRTMELGDLKTGVHTLQWDGN
FT                   NDGGQPLADGKYSITVSASDADANPVKTEALTYGQVKSVAYSTNGLRLDLGLAGQISML
FT                   DVRKVIGASGSA"
     atgaccaccg tcaacgaaac cacttcccag gccggcctgg ccctggcgca ggccggctcc        60
     aacagcgccg cccagggcat ccaggatcaa ttcctgacgc tgctggtgac gcagctgcgc       120
     aaccaggacc cgctcaaccc gatggagaac gccgagctga cttctcagct ggcgcagatc       180
     tccacggtgg aaggcatcaa caacctcaag aacaccatgc tcgccatcag cgggcagatc       240
     gacgtgtcgc agtcgatgga cgcggtgtcg atgataggca agggcgtgct gatgccgggc       300
     gacaaggtgt cgctgggcac cgaccccaac gaccccgccc agcgcggcgc cacgccgttc       360
     ggcatcgatc tgcagggcga cgcgaccaag gtgacggtca aggtgctgga tccctcgggc       420
     gccgtggtgc gcaccatgga gctgggcgac ctcaagaccg gtgtgcacac gctgcaatgg       480
     gacggcaaca acgacggcgg ccagccgctg gccgacggca agtattcgat cacggtgagc       540
     gccagcgacg ccgacgcgaa tccggtcaag accgaggcgc tgacctacgg acaggtcaag       600
     agcgtggcgt attccaccaa cggcctgcgc ctggacctgg gcctggccgg ccagatcagc       660
     atgctggatg tgcgcaaggt catcggggct tccgggtcgg catga                       705
//

If you have problems or comments...

PBIL Back to PBIL home page