(data stored in ACNUC1104 zone)

EMBL: BX640427.FLGE

BX640427.FLGE        Location/Qualifiers
FT   CDS_pept        200795..202216
FT                   /transl_table=11
FT                   /gene="flgE"
FT                   /gene_synonym="flaK"
FT                   /gene_synonym="fla FV"
FT                   /locus_tag="BPP1488"
FT                   /product="flagellar hook protein FlgE"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1376"
FT                   /db_xref="GOA:Q7WA94"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR011491"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037058"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA94"
FT                   /protein_id="CAE36790.1"
FT                   /translation="MGFGQGLSGLNAASQNLDVIGNNIANSGTVGFKSGAASFADVYAS
FT                   SRVGLGVKVSAINQRFTVGNISTTGGEYDMAIDGGKGFFRLTDQSGGVFYSRNGEFMVD
FT                   KNFYIVNAQGFRLTGYPAGGVGAQPVDLQLPQGNIAPQATSTAGLQTNLNANAKVIDPN
FT                   DTPADDGAVELDGTTYRFTNASGTFAWVAPAPLDGTYNGGDIVIAGGAVTGDLASQPGY
FT                   QPYKPLVAGIPFDPTNPLSYTDQVPTTVYDSLGNSHQMIQYFAKRPAVGTESVYEVYYV
FT                   LDGQPMQVNGGASQTLNFDTAGNLLNQPPTAQVTFANPGGNAAPADPLAITVSYNGVTQ
FT                   YGSDFAPKVVQNGYSSGEFMGLSVGKDGSLVAKYTNGETQTIGTLVLANFNNVQGLQPV
FT                   GNNAWVETSESGQATLGQPGTNGLATIAGQALEASNVDMSRELVNMIVAQRTYQANAQT
FT                   IKTQDEVMQVLMNMR"
     atgggattcg gacaaggatt gagcggcctg aacgccgcct cgcagaacct ggatgtaatc        60
     ggcaataaca tcgccaactc gggcacggtc ggcttcaagt cgggcgcggc ctcgttcgcc       120
     gacgtgtacg ccagctcgcg cgtcggcctg ggcgtgaaag tcagcgccat caaccagcgc       180
     ttcacggtgg gcaatatttc gaccaccggc ggcgaatacg acatggcgat cgacggcggc       240
     aagggctttt tccgcctgac cgaccagagc ggcggggtgt tctactcgcg caacggcgag       300
     ttcatggtcg acaagaactt ctacatcgtc aacgcccagg gctttcgcct gaccggctat       360
     ccggccggcg gcgtgggcgc ccagccggtg gacctgcaac tgcctcaagg caacatcgcg       420
     ccgcaagcga ccagcaccgc gggcctgcag accaacctga acgccaacgc caaggtcatc       480
     gaccccaacg acacgccggc tgacgatggc gcggtggagc tggacggcac gacctaccgt       540
     ttcaccaacg cgagcggcac cttcgcctgg gtcgcgcccg cgccgctcga cggcacctac       600
     aacggcggcg acatcgtgat cgccggcggc gcggtgaccg gcgaccttgc cagccagccg       660
     ggctaccagc cctacaagcc gctggtggcc ggcatcccgt tcgacccgac caatccgctg       720
     tcgtacaccg accaggtgcc gaccacggtc tacgactcgc tgggcaactc gcaccagatg       780
     atccagtact tcgccaagcg ccccgcggtg ggcaccgaga gcgtgtacga ggtctattac       840
     gtgctggacg gccagcccat gcaggtcaac ggcggcgcct cgcagacgct gaacttcgac       900
     accgccggca atctgctcaa ccagccgccc accgcccagg tgacgttcgc caacccgggc       960
     ggcaacgccg cgccggccga cccgctggcg atcaccgtca gctacaacgg cgtcacccag      1020
     tacggcagcg atttcgcgcc caaggtggtg cagaacggtt actccagcgg cgaattcatg      1080
     ggcctgtcgg tgggcaagga cggcagcctg gtggccaagt acaccaacgg cgagacgcag      1140
     accatcggca ccctggtgct ggccaacttc aacaacgtgc agggcctgca gccggtgggc      1200
     aacaacgcct gggtggagac gtccgaatcg ggccaggcca cgctgggcca gccgggcacc      1260
     aacggcctgg cgaccatcgc cgggcaggcg ctggaggcct ccaacgtgga catgagccgc      1320
     gagctggtca acatgatcgt ggcccagcgc acctatcagg ccaacgcgca gaccatcaag      1380
     acgcaggacg aagtcatgca ggtcttgatg aacatgcgct aa                         1422
//

If you have problems or comments...

PBIL Back to PBIL home page