(data stored in ACNUC1104 zone)

EMBL: BX640427.FLGF

BX640427.FLGF        Location/Qualifiers
FT   CDS_pept        202255..203019
FT                   /transl_table=11
FT                   /gene="flgF"
FT                   /gene_synonym="flaX"
FT                   /gene_synonym="fla FVI"
FT                   /locus_tag="BPP1489"
FT                   /product="flagellar basal-body rod protein FlgF"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1377"
FT                   /db_xref="GOA:Q7WA93"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA93"
FT                   /protein_id="CAE36791.1"
FT                   /translation="MDRIIYTAMNGAARIAEHQTVLGNNMANVNTPGFREQIALYRSVP
FT                   MADGTSLPTRVSTVASTPGNNFEMGNMMTTGRELDVALAGPGWFALQTPQGEAYTRAGA
FT                   LQVGVNGLLQTATGQPVLSDQNAVIEVPDQASLTIASDGTVTAIGAGDPPNNILNLGRL
FT                   KMVNPPPQQLVHGDDGVFRMPQQPGGQPAAPLPADPSQRLLSGVLEGSNASPMGAMVGM
FT                   IQNARRFEMQMQVIREADKNAERANGILAAAS"
     atggaccgga tcatctacac cgccatgaac ggcgcggccc gcattgccga gcaccagacg        60
     gtgctgggca acaacatggc caacgtcaac acgccggggt tccgcgagca gatcgcgctg       120
     taccgctcgg tgcccatggc cgacggcacc tcgctgccca cgcgggtctc gaccgtggcg       180
     tccacgcccg gcaacaactt cgagatgggc aacatgatga ccacggggcg cgagctggac       240
     gtggcgctgg ccgggccggg ctggttcgcg ctgcagacgc cgcagggcga ggcctatacc       300
     cgcgccggcg cgttgcaggt gggcgtcaac ggcctgctgc agaccgccac cgggcagcct       360
     gtgctgtcgg accagaacgc ggtcatcgag gtgccggacc aggctagcct gacgatcgcg       420
     tcggacggca cggtcaccgc catcggcgcg ggcgatccgc ccaacaacat tctcaacctg       480
     ggccggctga agatggtcaa cccgccaccg cagcagctgg tgcatggcga cgacggggtg       540
     ttccgcatgc cgcagcagcc cggcggccag cccgccgcgc cgctgccggc cgatccgtcg       600
     cagcgcctgt tgagcggcgt gctggagggc agcaacgcca gccccatggg cgccatggtg       660
     ggcatgatcc agaacgcgcg gcggttcgag atgcagatgc aggtgatacg cgaggcggac       720
     aagaacgccg agcgcgccaa cgggattctg gccgcggcca gctga                       765
//

If you have problems or comments...

PBIL Back to PBIL home page