(data stored in ACNUC1104 zone)

EMBL: BX640427.FLGH

BX640427.FLGH        Location/Qualifiers
FT   CDS_pept        203845..204537
FT                   /transl_table=11
FT                   /gene="flgH"
FT                   /gene_synonym="flaY"
FT                   /gene_synonym="fla FVIII"
FT                   /locus_tag="BPP1491"
FT                   /product="flagellar L-ring protein precursor"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1379"
FT                   /db_xref="GOA:Q7WA92"
FT                   /db_xref="InterPro:IPR000527"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WA92"
FT                   /protein_id="CAE36793.1"
FT                   /translation="MMLKTVLRLPVCAALLALAAGCAMIPPEPVVTGPLTAPPPPPPQP
FT                   SARPNGSIYQPSAYGNYPLFEDRRPRNVGDIVTIVLEEKTNAAKGVATNTSRDGSATLG
FT                   VAAAPRFMDGVINDKLDTDISGGNTANGTGKSSANNTFTGTITTTVIGVLPNGNLQIAG
FT                   EKQIAINRGSEYVRFSGVVDPRSITGSNTVSSTRVADARIEYRSKGVMDEVQTMGWLQR
FT                   FFLIASPF"
     gtgatgctga agaccgtatt gcgcctgccg gtctgcgccg cgctgctggc gctggccgcg        60
     ggctgcgcga tgattccgcc cgaaccggtg gtgaccggtc cgctgaccgc gccgcctccg       120
     ccgccgccgc aaccctcggc gcggcccaac ggctcgatct accagccctc ggcctacggc       180
     aactatccgc tgttcgagga ccgccggccg cgcaacgtgg gcgacatcgt caccatcgtg       240
     ctggaggaaa agaccaacgc cgccaagggc gtggccacca acaccagccg cgacggctcg       300
     gccacgctgg gcgtggcggc cgcgccgcgc ttcatggacg gcgtcatcaa cgacaagctg       360
     gataccgata tctcgggcgg caataccgcc aacggcaccg gcaagagcag cgccaacaac       420
     accttcaccg gcaccatcac gaccaccgtg atcggggtgc tgcccaacgg caatctgcag       480
     atcgccggcg agaagcagat cgccatcaac cgcggcagcg agtacgtgcg cttctcgggc       540
     gtggtcgacc cgcgatcgat caccggcagc aatacggtgt cgtcgacccg ggtggccgac       600
     gcgcgcatcg aataccgcag caagggcgtc atggacgaag tccagaccat gggctggctg       660
     caacgctttt tcctgatcgc ttcgccgttc tga                                    693
//

If you have problems or comments...

PBIL Back to PBIL home page