(data stored in ACNUC1104 zone)

EMBL: BX640427.FLGK

BX640427.FLGK        Location/Qualifiers
FT   CDS_pept        206780..208426
FT                   /transl_table=11
FT                   /gene="flgK"
FT                   /gene_synonym="flaS"
FT                   /gene_synonym="flaW"
FT                   /locus_tag="BPP1494"
FT                   /product="flagellar hook-associated protein 1"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1382"
FT                   /db_xref="GOA:Q7WA89"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA89"
FT                   /protein_id="CAE36796.1"
FT                   /translation="MNLYNLALTGLNASQAGLETTSHNINNATTVGYSRQRVITSTAGA
FT                   GETGQGFFGRGVQVDTVTRQYDSFLYRQLVGAQGSSAQLSTHLAQVSQVNNLFGDRTVG
FT                   ITPALAGLFTSTNAAATKPADPAVRADMIGKANSLVTQINTAYQELENQRNGLNTQIST
FT                   TVEQVNSYLERINDLNKQIVIARGKDGHAPNDLLDQRDQAVSELNQLTGIRFYEQGDTF
FT                   NITLQSGQTLLSGTTVYPLQAVPSASDPKRLAVAYTLPSGPGTTIQVEMNDSEVTGGQL
FT                   GGLLSFRSQSLDAVQDQLGQLAIGLAMAFNAQHREGYDLDGQPGGDMFGLQAPAAIRNS
FT                   GNTSTGEWQSAYTDADAIRASAYRIQYDGANYTVTRLSDGSSFDVTPSGTPPTLSFDGL
FT                   TLTGSGTPAAGDAWTLQPARDAARDLKQLISDPSKLALADSALGTTNGNNGLKLAELQT
FT                   AKVLGNGSMSLNEMFSQLVNNVGVQTQQVSTANTAQANLVKQQATAHLSVSGVNLNEEY
FT                   VNLTIFQEQYQASAKILDVASTVFDTLLGLR"
     atgaatctgt acaacttggc gctgaccggc ctgaacgctt cgcaagccgg cctggagacg        60
     accagccaca acatcaacaa tgccacgacg gtcggctaca gccgccagcg tgtcatcacc       120
     tcgaccgccg gcgccggcga gaccgggcag ggctttttcg gccgcggtgt gcaggtggat       180
     accgtgacgc gccagtacga tagcttcctg taccgccagc tggtcggcgc gcaaggcagc       240
     agcgcccagc tgagcaccca cctcgcgcaa gtgtcgcagg tgaacaatct gttcggtgat       300
     cgcaccgtcg gcatcacgcc ggcgctcgcg ggcctgttca ccagcaccaa cgcggcggcc       360
     accaagccgg ccgatccggc cgtgcgcgcc gacatgatcg gcaaggccaa cagcctggtc       420
     acccagatca ataccgccta ccaggagctg gaaaaccagc gcaacggcct caatacgcag       480
     atctcgacca cggtcgagca ggtcaacagc tacctggagc gcatcaacga cctgaacaag       540
     cagatcgtga tcgcgcgcgg caaggacggg cacgcgccca acgacctgct ggaccagcgc       600
     gaccaggccg tctcggaact gaaccagctg accggcatcc gcttctacga gcagggcgat       660
     acgttcaaca tcacgctgca aagcggccag accctgttgt cgggcacgac cgtctatccg       720
     ctgcaggcgg tgccctcggc cagcgatccc aagcgcctgg cggtggccta tacgctgccg       780
     tccgggccgg gcaccaccat ccaggtggaa atgaacgaca gcgaggttac cggcggccag       840
     ctgggcggcc tgctgagttt ccgcagccag tcgctggacg cggtgcagga ccagctgggc       900
     cagctggcca tcgggctggc tatggcgttc aacgcgcaac accgcgaggg ctatgacctg       960
     gacggccagc cgggcggcga catgttcggc ctgcaggcgc cggcggcgat ccgcaattcc      1020
     ggcaatacca gcacgggcga gtggcagtcg gcctataccg acgccgacgc catccgcgcc      1080
     agcgcctatc gcatccagta cgacggcgcc aactacacgg tgacgcgcct gtccgatggc      1140
     agcagcttcg acgtgacgcc cagcggcacg ccgcccacac tgtcgttcga cggcctgacc      1200
     ctgaccggca gcggcacgcc ggccgccggc gacgcctgga cgctgcagcc ggcccgcgac      1260
     gcggcgcgcg acctcaagca attgatcagc gatcccagca agctggcgct ggccgattcg      1320
     gcgctcggca cgaccaacgg caacaacggc ctgaagctgg ccgagctgca gaccgccaag      1380
     gtgctgggca acggcagcat gagcctgaac gagatgttct cgcagctcgt caataacgtg      1440
     ggcgtgcaga cgcagcaggt cagcacggcc aacacggcgc aggccaacct ggtcaagcag      1500
     caggccaccg cccacctgtc ggtgtcgggc gtgaacctga acgaagagta cgtcaacctg      1560
     acgatcttcc aggagcagta ccaggccagc gccaagatcc tggatgtggc cagcacggtg      1620
     ttcgacacct tgctgggcct gcgctga                                          1647
//

If you have problems or comments...

PBIL Back to PBIL home page