(data stored in ACNUC1104 zone)

EMBL: BX640427.FLGL

BX640427.FLGL        Location/Qualifiers
FT   CDS_pept        208460..209992
FT                   /transl_table=11
FT                   /gene="flgL"
FT                   /gene_synonym="flaT"
FT                   /gene_synonym="flaU"
FT                   /locus_tag="BPP1495"
FT                   /product="flagellar hook-associated protein 3"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1383"
FT                   /db_xref="GOA:Q7WA88"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR013384"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA88"
FT                   /protein_id="CAE36797.1"
FT                   /translation="MRLSTALIYQNGLNGVLNQEAAMARLQEQLSSGRRVLTPADDPLA
FT                   AALAVNVSQTSSMNSNYDANRKQAEQALGAQTNTLQSVVKNMQEMLKRVVEAGNGTMSD
FT                   ADRQALVIALKGAREELVGLANATDGNGQYLFSGYKGFTQPYSFDAATGKVTYNGDLGQ
FT                   RGIQVDQSRLMSGGDVGSDIFNSVTSGTLAYIADAGAGNAGTGQYSAVSFDGPRAGNYV
FT                   GRDFRIEFTRDAVTDELQYSVLSDPPVVPPEQPLPANMPYSEGSVIDMNGVSIKLSGQP
FT                   EAGDVFTVETPKSWKMGVQGDAANTGSATLTPVSLPDGLTGKNLSVAFLDDGAGGLLYS
FT                   VTSTPPDPSLPANVPVKPGDVIDIGGLKVKVDGQPAAGDTYAVTTPKSANVDVFDTLND
FT                   LIGALDTPISGDPQAAAALANTLATANKKLNLSLDNVLTVQASVGARLNELEALGNTGA
FT                   QKGLSYVKQLSDLEDVNIYQATSDLLLRQVALQAASLALQRIQGNSLFSMGR"
     atgcgtttga gcaccgcact gatttaccag aatggcctga acggcgtgct gaaccaggaa        60
     gccgccatgg cgcgcctgca ggagcagctc tccagcggcc gccgggtgtt gacgccggcc       120
     gacgatccgc tggccgccgc gctggcggtc aacgtctcgc agacgtccag catgaacagc       180
     aactacgacg ccaaccgcaa gcaggccgag caggcgctgg gcgcccagac caatacgctg       240
     cagtcggtcg tcaagaacat gcaggaaatg ctcaagcggg tggtcgaggc cggcaacggc       300
     accatgagcg atgccgaccg ccaggcgctg gtcatcgcgc tcaagggcgc gcgcgaggaa       360
     ctggtggggc tggccaacgc cacggatggc aacggacagt acctgttctc cggctacaag       420
     ggctttaccc agccctacag cttcgacgcc gcgaccggca aggtgaccta taacggcgac       480
     ctgggccagc gcggcatcca ggtcgaccag agccgcctga tgagcggcgg cgacgtcggc       540
     agcgacattt tcaacagcgt caccagcggc acgctggcct atatcgccga tgccggcgcg       600
     ggcaatgccg gcaccggaca atacagcgcg gtgtcgttcg acggtccgcg cgccggcaac       660
     tacgtgggcc gcgatttccg tatcgagttc acgcgcgatg cggtgaccga cgagctgcag       720
     tactcggtgc tcagcgaccc gccggtggtg ccgcccgaac agccgctgcc ggccaatatg       780
     ccttactcgg agggctccgt gatcgacatg aacggcgtgt cgatcaagtt gagcggccag       840
     cccgaggcgg gcgacgtgtt caccgtggag acgcccaagt cctggaagat gggcgtgcag       900
     ggcgacgcgg ccaacaccgg atcggccacg ctgacgccgg tgtccctgcc ggacgggctg       960
     accggcaaga acctgagcgt ggcgttcctg gacgacggcg ccggcggcct gctctacagc      1020
     gtgaccagca cgccgccgga ccccagcctg cctgccaacg tgccggtcaa gccgggcgat      1080
     gtcatcgaca tcggcggcct gaaggtcaag gtggacggcc agccggccgc cggcgacaca      1140
     tacgccgtga ccacgccgaa gtcggccaac gtggacgtgt tcgacacgct caacgacctg      1200
     atcggcgcgc tcgatacgcc catcagcggc gatccgcagg ccgccgcggc gctggccaac      1260
     acgctggcca cggccaacaa gaagctgaac ctgtcgctgg acaacgtgct gacggtgcag      1320
     gcttcggtgg gcgcgcgcct caatgaactg gaagcgctgg gcaataccgg cgcgcagaag      1380
     ggcttgtcgt acgtcaagca gctgtcggac ctggaggacg tgaacatcta ccaggcgacc      1440
     agcgacttgc tgttgcggca ggttgcattg caggcggcct cgctggccct gcagcgcata      1500
     cagggaaaca gcctgttctc gatgggtcga tag                                   1533
//

If you have problems or comments...

PBIL Back to PBIL home page