(data stored in ACNUC1104 zone)

EMBL: BX640427.FLID

BX640427.FLID        Location/Qualifiers
FT   CDS_pept        complement(228230..229603)
FT                   /transl_table=11
FT                   /gene="fliD"
FT                   /gene_synonym="flbC"
FT                   /gene_synonym="flaV"
FT                   /locus_tag="BPP1517"
FT                   /product="flagellar hook-associated protein 2"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1410"
FT                   /db_xref="GOA:Q7WA70"
FT                   /db_xref="InterPro:IPR003481"
FT                   /db_xref="InterPro:IPR010809"
FT                   /db_xref="InterPro:IPR010810"
FT                   /db_xref="InterPro:IPR040026"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA70"
FT                   /protein_id="CAE36819.1"
FT                   /translation="MATISSLGSSGLELEGILEKLQAAEEKKLTLITARQASYETRISA
FT                   YSKIQAAVEAVQKAAATLGSIDTLSAVKAVVSGDGLSVKTAAGAVPGQYTVNIDKLATA
FT                   QNLQSGELDSRTDKHGTGGSIEIVQKDGTTTTVTLGEDTSLNGIVKAINGTDGLDVRAT
FT                   VISDGNGKHYLMLNNKTEGTEAAVTRITVSGNQEVADILDFDAANAGASNLTVQLAAQK
FT                   AELTINGIPVVSDTNTVETAIDGLTLTLTKQTAAPLTVTVSSDPSVAATAVNDFVKAYN
FT                   GLQTTIADLTAFDVKAEKQSALTGDGTTRNIQSAIAAALRVATGEGTLRTLSQLGITTD
FT                   PKTGSLKTDTEKLEAALRDNPADVARIFSGPFGLGEKVKLATEQILGDEGSIKIRQEGL
FT                   EETLESLQNQYDRQKLSIAATIEAYRKQFVQLDVFVTQMNNTSNYLSQQFAALSGTKK"
     atggccacca tttcctctct cgggtcctcc ggcctggagc ttgagggcat cctggaaaag        60
     ctgcaggcag ccgaagagaa gaaactgacg ctgatcaccg cgcgccaggc gagctacgag       120
     acgcgcattt cggcctacag caagatccag gccgcggtcg aggccgtcca gaaggccgcc       180
     gccacgctcg gcagcatcga cacgctcagc gccgtgaagg ccgtggtctc cggcgacggg       240
     ctgtcggtga agaccgcggc cggcgccgtg ccgggtcaat acaccgtcaa catcgacaag       300
     ctggccaccg cgcagaacct gcagtcgggc gagctggaca gccgcacgga caagcacggc       360
     acgggcggct cgatcgagat cgtccagaag gacggcacga ccacgaccgt cacgctgggc       420
     gaggacacgt cgctgaacgg catcgtcaag gccatcaacg gcaccgacgg cctggacgtg       480
     cgcgccaccg tcatcagcga cggcaatggc aagcactacc tgatgctgaa caacaagacc       540
     gaaggcaccg aagccgcggt cacccggatc acggtgagcg gcaaccagga agtcgcggac       600
     attctcgact tcgacgcggc caacgccggc gcctccaatc tgacggtgca gctggccgcc       660
     cagaaggccg agctgaccat caacggcatc cccgtggtca gcgacaccaa tacggtcgag       720
     accgccatcg acgggctgac gctgaccctg accaagcaga ccgcggcgcc gctgaccgtg       780
     accgtctcca gcgacccgag cgtggccgcc acggccgtca acgatttcgt caaggcctac       840
     aacggcctgc agaccaccat cgcggacctg acggcattcg acgtcaaggc ggagaaacag       900
     agcgccctga ccggcgacgg caccacccgc aacatccagt cggccatcgc cgcggcgctg       960
     cgcgtggcca ccggcgaggg caccctgcgc acgctgagcc agcttggcat caccaccgat      1020
     cccaagaccg gctcgctcaa gaccgatacc gaaaagctgg aagccgccct gcgcgacaac      1080
     ccggccgacg tggcgcgcat tttctcgggt ccgttcggcc tgggcgaaaa ggtgaagctg      1140
     gcgaccgagc agatcctcgg cgacgagggc tcgatcaaga tccgccagga aggcctggag      1200
     gaaacgctcg agtcgctgca gaaccagtac gaccgccaga aactgagcat cgccgcgacc      1260
     atcgaggcct accgcaagca gttcgtgcag ctcgatgtct tcgtcacgca gatgaacaac      1320
     accagcaact acctgtccca acagttcgcc gccctgtccg gcaccaagaa gtaa            1374
//

If you have problems or comments...

PBIL Back to PBIL home page