(data stored in ACNUC1104 zone)

EMBL: BX640427.FLIJ

BX640427.FLIJ        Location/Qualifiers
FT   CDS_pept        complement(219430..219864)
FT                   /transl_table=11
FT                   /gene="fliJ"
FT                   /gene_synonym="flaO"
FT                   /gene_synonym="flaS"
FT                   /locus_tag="BPP1506"
FT                   /product="flagellar protein FliJ"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1399"
FT                   /db_xref="GOA:Q7WA80"
FT                   /db_xref="InterPro:IPR012823"
FT                   /db_xref="InterPro:IPR018006"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA80"
FT                   /protein_id="CAE36808.1"
FT                   /translation="MPSQLPLDMLIGLAKDSTDEAARELGRLSAERNNAEQQFNMLQDY
FT                   RQDYLQRMQSGMSAADCHNYQRFIATLDDAIGQQRHVLHRAEAHLNDGRLNWQQQKRKL
FT                   NSFDTLAQRESRTQALLEARREQRVNDEYSARLVRRQAGF"
     atgcctagcc aattgccact ggacatgctg atcggcctgg ccaaggacag caccgacgag        60
     gccgcccgcg aactgggccg cctgagcgcc gagcgcaaca acgccgagca gcagttcaac       120
     atgctgcagg actatcgcca ggactacctg caacgcatgc agtcgggcat gtcggccgcc       180
     gactgccata actaccagcg cttcatcgcc acgctggacg atgccatcgg ccagcaacgc       240
     catgtcctgc accgggccga ggcgcacctg aacgacgggc gcctcaactg gcagcagcaa       300
     aagcgcaagc tgaattcgtt cgacaccctg gcgcagcgcg aatcgcgcac ccaggctctg       360
     ctcgaggcgc ggcgcgagca acgcgtcaac gatgaatact ccgcccgact ggtacgccgc       420
     caggcgggtt tctga                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page