(data stored in ACNUC1104 zone)

EMBL: BX640427.FLIK

BX640427.FLIK        Location/Qualifiers
FT   CDS_pept        complement(218108..219424)
FT                   /transl_table=11
FT                   /gene="fliK"
FT                   /gene_synonym="flaE"
FT                   /gene_synonym="flaR"
FT                   /locus_tag="BPP1505"
FT                   /product="flagellar hook-length control protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1398"
FT                   /db_xref="GOA:Q7WA81"
FT                   /db_xref="InterPro:IPR001635"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="InterPro:IPR038610"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA81"
FT                   /protein_id="CAE36807.1"
FT                   /translation="MSRNRTAAMTTATLPIPALTPAPGPAAQGGPAAAGKGPSFSQVLA
FT                   RQQGGKPGEAGTPAAPGAQAGAPAQGPATQNPAGAGKPGKPGDTAALPVDGQQEPAAET
FT                   AADAATLAALAAQTAPAPALPLQALEIAAEAAAVNAQVAAATQAAGAAARQPAHAALLA
FT                   GQPAAPAAAGAPPADTAPAMPPALPQAAQPAVAAQAAVAASAPNAPAAETAATPPAAPS
FT                   LPHPLPSTGGTPQDGGEAAEPPATAPAQPQPLAAAEHGAALHAAAQAHIAARQAVGNPA
FT                   PASLPAAAQPLGLEVAAPVGSSQWGQDLGRQLVTISHDARQGHHTAELRLDPPDLGPLR
FT                   VSINLHEGVASAAFVSVHAAVRQAVEAALPQLQQALAQAGISLGQTSVGDQSAQQGFAE
FT                   QQGRGAGASGGSAAGADSETVVVAATPARNADALVDTFA"
     atgagccgta acaggacagc cgctatgacg accgctaccc tgcccattcc cgccctgacg        60
     cctgcgccgg gtccggccgc gcaaggcggc ccggccgccg ccggcaaggg tcccagcttc       120
     tcgcaagtgc tggcccgcca gcaaggcggc aaacccggcg aagccggcac gcctgccgcg       180
     cccggcgccc aggccggcgc gccggcccaa ggccccgcga cccagaaccc ggccggcgcc       240
     ggcaaacccg gcaagcccgg cgacaccgcg gccttgccgg tggacggcca gcaggagccc       300
     gctgccgaga cggccgccga cgccgccacg ctggccgcgc tggcggcgca aaccgcgccg       360
     gctcccgcgc tgccgctgca ggccctggag atcgccgccg aagccgccgc cgtcaacgcc       420
     caggttgcgg ccgccaccca ggcggcaggc gccgccgccc ggcaacccgc ccacgcggcg       480
     ctgctggccg gccagccggc cgcgccggcc gccgccggcg ccccgcccgc cgataccgcg       540
     ccggccatgc cgccagccct gccgcaagcc gcgcaaccgg ccgttgcggc ccaggccgcc       600
     gtggccgcca gcgcgcccaa cgcgccggcc gccgaaaccg ccgcaacgcc gcccgccgcg       660
     cccagcctgc cgcacccgct gccgtcgacc ggcggcacgc cgcaagacgg cggcgaggcg       720
     gccgagcccc ctgccaccgc gccggcccag ccgcaaccgc tggccgcggc cgaacacggc       780
     gcggccctgc acgcggcggc ccaggcgcac attgcggcgc gccaggctgt cggcaacccg       840
     gcccccgcaa gcctgcccgc cgccgcgcag ccgctggggc tggaggtcgc cgcgccggtg       900
     ggatccagcc aatggggcca ggacctgggc cgccagctcg tcaccatcag ccacgatgct       960
     cgccagggcc accatacggc cgaactgcgc ctggatccgc ccgacctggg ccccttgcgg      1020
     gtcagcatca acctgcacga aggcgtggcc agcgccgcgt tcgtctccgt ccacgcggcg      1080
     gtgcgccagg cggtcgaggc cgccttgccg caactgcagc aggcgctggc ccaggccggc      1140
     atctcgctgg gccagaccag tgtcggcgac cagtccgcgc agcagggctt tgccgagcag      1200
     caaggccgcg gcgccggcgc gtcgggcggc agcgcagcgg gcgccgacag cgagacggtc      1260
     gtcgtggccg ccacgccggc gcgcaacgcc gatgccttgg tcgacacctt cgcatga         1317
//

If you have problems or comments...

PBIL Back to PBIL home page