(data stored in ACNUC1104 zone)

EMBL: BX640427.FLIL

BX640427.FLIL        Location/Qualifiers
FT   CDS_pept        complement(217394..217966)
FT                   /transl_table=11
FT                   /gene="fliL"
FT                   /gene_synonym="fla AI"
FT                   /gene_synonym="fla QI"
FT                   /gene_synonym="cheC1"
FT                   /locus_tag="BPP1504"
FT                   /product="flagellar protein FliL"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1395"
FT                   /db_xref="GOA:Q7WA82"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA82"
FT                   /protein_id="CAE36806.1"
FT                   /translation="MATTKTSTMPPRTTLPLRPGGAGRLLRPLLMLLVLALVVAASVAG
FT                   TWYFMKRMQPPVAVPVQLGVGQPQATPMQFVAPPATPPVVPAPIFIPLEAFTVTLQNAD
FT                   SERILHVGITLRVSDEQTRQRIEKYMPEVRSRILMVLSSQSPQAVQTLQGKTEMAHAIT
FT                   EAVKRPFSPLPDGQYVTDALFTAFVVQ"
     atggcaacga ccaaaacttc caccatgccg ccgcgcacga cccttcccct gcgcccgggc        60
     ggcgccggcc ggctgcttcg cccgctgctc atgctgctgg tcctggccct ggtggtcgcc       120
     gccagcgtgg ccggcacgtg gtacttcatg aagcgcatgc agccgccggt ggccgtaccc       180
     gtgcaactgg gcgtgggcca gccgcaggca acgcccatgc agttcgtcgc gccgccggcg       240
     acgccgccgg tggtgccggc gccgatcttc atcccgctgg aagcgttcac cgtcacgctg       300
     cagaacgccg acagcgagcg catcctgcac gtcgggatca cgctgcgcgt cagcgacgag       360
     cagacgcgcc agcgcatcga gaagtacatg cccgaggtgc gcagccgcat cctgatggtg       420
     ctgtcctcgc aatcgccgca ggcggtccag acgctgcagg gcaagaccga gatggcgcac       480
     gccatcaccg aggcggtgaa acgcccgttc tcgccgctgc ctgacggcca gtacgtgacc       540
     gacgcgctgt tcacggcatt cgtggtgcaa taa                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page