(data stored in ACNUC1104 zone)

EMBL: BX640427.FLIM

BX640427.FLIM        Location/Qualifiers
FT   CDS_pept        complement(216381..217391)
FT                   /transl_table=11
FT                   /gene="fliM"
FT                   /gene_synonym="fla AII"
FT                   /gene_synonym="fla QII"
FT                   /gene_synonym="CheC2"
FT                   /locus_tag="BPP1503"
FT                   /product="flagellar motor switch protein FliM"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1394"
FT                   /db_xref="GOA:Q7WA83"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR001689"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA83"
FT                   /protein_id="CAE36805.1"
FT                   /translation="MAYEAFLSQDEVDALLAGVTGESDEKQPAGDEAGAPRAYDLSSPE
FT                   RVVRRRMQTLELINERFARHMRNVLLNFMRRNADITVGAIKILKYADFERNLPVPSNLN
FT                   MIQMKPLRGTALFTYDPNLVFLVIDSLFGGDGRYHTRVEGRDFTTTEQRIIRRLLNLTL
FT                   ESYGKSWDPVYPIEFEYVRSEMHTKFASITGNNEVVVVSPFHIEFGATGGDLNICLPYS
FT                   MIEPVRDLLTRPLQDTALEEVDQRWAQQLQSQVRSADIDLVAEFGHIPSSIGELMRMKT
FT                   GDVLPIAVPETVTAHVDGVPLMEYGYGVFNGRYALRVQNLINYDDTDSNEAPDHD"
     atggcctacg aggcttttct ttcgcaggac gaagtcgacg cgctgctggc cggagtcacc        60
     ggcgaaagcg acgagaagca gccggccggc gacgaggccg gcgccccgcg cgcctacgac       120
     ctcagctcgc ccgaacgcgt ggtgcgccgg cgcatgcaga cgctggagct catcaacgag       180
     cgtttcgcgc gccacatgcg caacgtgctg ctgaacttca tgcgccgcaa cgccgacatc       240
     accgtcggcg ccatcaagat cctgaagtac gccgatttcg agcgcaacct gccggtgccc       300
     agcaatctga acatgattca gatgaagccg ctgcgcggca ccgccctgtt cacctacgac       360
     ccgaacctgg tgttcctggt gatcgacagc ctgttcggcg gcgacggccg ctatcacacc       420
     cgcgtggaag gccgcgactt caccacgacc gagcagcgca tcatccgccg cctgctcaac       480
     ctgacgctgg agagctacgg caaatcctgg gacccggtct acccgatcga gttcgagtac       540
     gtgcgctcgg aaatgcacac caagttcgcc agcatcaccg gcaataatga agtggtggtg       600
     gtgtcgccct ttcacatcga attcggcgcg accggcggcg acctgaatat ctgcctgccc       660
     tactcgatga tcgaaccggt gcgcgacctg ctgacgcgcc cgctgcagga caccgcgctc       720
     gaggaagtcg accagcgctg ggcgcagcag ctacagagcc aggtgcgcag cgccgacatc       780
     gacctggtgg cggaattcgg ccacatccct tcgagcatcg gcgagctgat gcgcatgaag       840
     accggcgacg tgctgccgat cgccgtgccc gagaccgtta ccgcccacgt cgacggcgta       900
     ccgctcatgg agtacggcta tggcgttttc aacggccgat acgcgctgcg cgtgcaaaac       960
     ctgatcaatt acgacgatac cgattccaac gaggcccccg accatgactg a               1011
//

If you have problems or comments...

PBIL Back to PBIL home page