(data stored in ACNUC1104 zone)

EMBL: BX640427.FLIO

BX640427.FLIO        Location/Qualifiers
FT   CDS_pept        complement(215518..215859)
FT                   /transl_table=11
FT                   /gene="fliO"
FT                   /gene_synonym="flbD"
FT                   /gene_synonym="flaP"
FT                   /locus_tag="BPP1501"
FT                   /product="flagellar protein FliO"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1392"
FT                   /db_xref="GOA:Q7WA84"
FT                   /db_xref="InterPro:IPR022781"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA84"
FT                   /protein_id="CAE36803.1"
FT                   /translation="MTESAVLRVVIGLALVIAAILVSAWLARRSGLIQRHGGALLRQVG
FT                   GMSLGPRQRVVVLEIEGTWLVLGVTPNQLTTLHTLPAGQLPDPSPAAAGTFAAKLGQAL
FT                   QRGHRVDRP"
     atgaccgaat ccgccgtcct gcgcgttgtc atcggcctgg cgctggtgat cgcggccatc        60
     ctggtttcgg cctggctggc gcggcgctcg ggcctgatcc agcgccacgg cggcgccttg       120
     ctgcgccagg tcggcggcat gagcctgggc ccgcgccaac gcgtggtggt gctcgaaatc       180
     gaaggaacct ggctggtgct gggtgtcacg cccaaccagt tgaccaccct gcacaccctg       240
     ccggccggcc agctgcccga tccttcgccg gccgcggccg gcacctttgc cgccaaactg       300
     ggccaggcgc tgcagcgcgg ccatcgagta gacaggccct ag                          342
//

If you have problems or comments...

PBIL Back to PBIL home page