(data stored in ACNUC1104 zone)

EMBL: BX640427.FLIP

BX640427.FLIP        Location/Qualifiers
FT   CDS_pept        complement(214715..215515)
FT                   /transl_table=11
FT                   /gene="fliP"
FT                   /gene_synonym="flaR"
FT                   /locus_tag="BPP1500"
FT                   /product="flagellar biosynthetic protein FliP"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1391"
FT                   /db_xref="GOA:Q7WA85"
FT                   /db_xref="InterPro:IPR005837"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA85"
FT                   /protein_id="CAE36802.1"
FT                   /translation="MPVMSISFRFSDTRPRAPWWPAMAAVAVAAAALWPSGALAQATLP
FT                   ALTATPGPNGSETYSLSMQTLLLMTSLSFLPAALLMMTGFTRIIIVLGLLRSAMGTAMS
FT                   PPNHVLIGLALFLTFYTMSPVFDKIYTDAYQPLAAGSIPFETAVERAGSPLHNFMLHQT
FT                   RENDLTLFANLANLPAMEDPSQVPMRILIPAFITSELKTAFQIGFTIFIPFLIIDLVVA
FT                   SVLMALGMMMVPPVTVALPFKLMLFVLADGWHLLLGSLAQSFYQ"
     ttgcccgtca tgagcatcag cttccgtttt tccgatacgc gcccgcgcgc gccctggtgg        60
     cccgccatgg ccgccgtcgc cgtggccgcc gccgcgctgt ggcccagcgg cgcgctggcg       120
     caggccaccc tgccggccct gaccgccacg cccgggccca atggctcgga gacctactcg       180
     ctcagcatgc agaccctgct gctgatgacc tcgctgtcgt tcctgcccgc ggcgctgctg       240
     atgatgaccg gcttcacgcg catcatcatc gtgctggggc tgctgcgcag cgccatgggc       300
     accgcgatgt cgccgcccaa ccacgtgctg atcgggctgg cgctgttcct gactttctac       360
     accatgtcgc cggtgttcga caaaatctac accgacgcct accagccgct ggccgcgggc       420
     agcattccgt tcgaaaccgc ggtcgagcgc gccggctcgc ccctgcacaa cttcatgctg       480
     caccagaccc gcgagaacga cctcaccctg ttcgccaacc tggccaacct gccggccatg       540
     gaagatccgt cccaggtgcc gatgcgcatc ctgatcccgg ctttcatcac cagcgaactg       600
     aagacggcgt tccagatcgg ctttaccatc ttcattccct ttctcatcat cgacctggtg       660
     gtcgccagcg tcctgatggc gctgggcatg atgatggtgc cgccggtcac cgtggcgctg       720
     ccgttcaagc tgatgctgtt cgtgctggcc gacggctggc acctgctgct cggctcgctg       780
     gcccagagct tctaccaata g                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page