(data stored in ACNUC1104 zone)

EMBL: BX640427.FLIQ

BX640427.FLIQ        Location/Qualifiers
FT   CDS_pept        complement(214429..214698)
FT                   /transl_table=11
FT                   /gene="fliQ"
FT                   /gene_synonym="flaQ"
FT                   /locus_tag="BPP1499"
FT                   /product="flagellar biosynthetic protein FliQ"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1390"
FT                   /db_xref="GOA:Q7WA86"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="InterPro:IPR006305"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA86"
FT                   /protein_id="CAE36801.1"
FT                   /translation="MTAETVMSMTYQALKVALALAGPLLLVTLIVGLVISIFQAATQIN
FT                   EMTLSFIPKLLAMCGTLVLLGPWLLGLLTDYIRQLIGQIPMLVS"
     atgaccgccg aaaccgtgat gtcgatgacc taccaggcgc tcaaggtcgc cctggcgctg        60
     gccggaccgc tgctgctggt cacgctcatc gtcggcctgg tcatcagcat cttccaggcc       120
     gccacgcaga tcaacgagat gacgctgtcg ttcatcccca agctgctggc catgtgcggc       180
     accctggtgc tgctgggccc ttggctgctg ggcctgctga ccgactacat ccgccagctg       240
     atcggccaga ttccgatgct ggtgtcctga                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page