(data stored in ACNUC1104 zone)

EMBL: BX640427.FLIS

BX640427.FLIS        Location/Qualifiers
FT   CDS_pept        complement(227794..228222)
FT                   /transl_table=11
FT                   /gene="fliS"
FT                   /locus_tag="BPP1516"
FT                   /product="flagellar protein FliS"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1409"
FT                   /db_xref="GOA:Q7WA71"
FT                   /db_xref="InterPro:IPR003713"
FT                   /db_xref="InterPro:IPR036584"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA71"
FT                   /protein_id="CAE36818.1"
FT                   /translation="MTYAARRPTGSYSVKSYSYIGLETQVMSATPERLITLLYAGARAA
FT                   IAQARLHLEAGRIVERGQAIGKAIRIVDEGLKLGLNQDAGGEVAANLARLYDYITRTLL
FT                   TANLKADKEQLDIADRLLADLSEAWQASVDHPAPAVPA"
     atgacgtacg ccgcgcgccg ccccaccggc tcctactctg tcaagtcata cagctatatc        60
     ggcctggaaa cccaggtcat gagcgccacc cccgagcgcc tgatcacctt gctgtatgcc       120
     ggggcgcgcg ccgccatcgc ccaggcccgc ctgcatctcg aggccggccg catcgtcgag       180
     cgcggacagg ccatcggcaa ggccatccgc atcgtcgacg agggattgaa gctggggctg       240
     aaccaggatg ccggcggcga ggtggcggcc aacctggcgc gcctgtatga ctacattacc       300
     cgtacgctgc tgaccgccaa cctgaaggcc gacaaggaac agctcgacat cgcggaccgc       360
     ttgctggcgg atctgtccga agcatggcag gcctcggtcg accaccctgc gcctgccgtt       420
     ccggcctga                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page