(data stored in ACNUC1104 zone)

EMBL: BX640427.FOLC

BX640427.FOLC        Location/Qualifiers
FT   CDS_pept        230596..231903
FT                   /transl_table=11
FT                   /gene="folC"
FT                   /gene_synonym="dedC"
FT                   /locus_tag="BPP1519"
FT                   /product="FolC bifunctional protein [includes:
FT                   folylpolyglutamate synthase and dihydrofolate synthase]"
FT                   /EC_number="6.3.2.17"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1412"
FT                   /db_xref="GOA:Q7WA68"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA68"
FT                   /protein_id="CAE36821.1"
FT                   /translation="MSTSRPDASADLPAWLQYLESIHAKAIDLGLDRVRQVAGRLDLSL
FT                   DGVKFMVGGTNGKGSTCAMLESILLAAGYRVGLYTSPHLIDFNERARINGEIASDAALV
FT                   QQFEAVEAARGDISLTYFEFTTLAILRLFAQSRLDAVVLEVGLGGRLDAVNIVDADCSI
FT                   ITSIDLDHTDWLGDTREKIGFEKAHIYRAGRPAICADPVPPQSLLDHVQAIGADLWLLG
FT                   RDYNYSGDRQQWAYGGRAQRRNALAYPALRGANQLLNAAAALAALEAVRDRLPVPQQAV
FT                   RVGLLQASLPGRFQILPGQPTVILDVAHNPHAAAVLAQNLDNMGFHPYTHAVFGMLADK
FT                   NVDGVIARLGSRVDHWYCAGLPGPRGLDGQALADHVRQVLPEAEGAAETPTVQACADPA
FT                   AAYAAAREKAGEGDRIIVFGSFLTVASVLQALGRKI"
     atgtccacct cccgccccga cgccagcgca gacctgcctg cctggctgca gtacctggaa        60
     tccatccacg ccaaggccat agacctgggg ctggaccggg tgcggcaggt ggccggccgg       120
     ctcgacctga gcctggacgg ggtcaagttc atggtgggcg gcaccaacgg caaggggtcc       180
     acctgcgcca tgctcgaatc catcctgctg gccgcgggct accgggtggg cctgtacacc       240
     tcgccccatc tcatcgattt caacgaacgc gcccgcatca acggcgaaat cgccagcgac       300
     gcggcgctgg tgcagcagtt cgaggcggtc gaggccgcgc gcggcgatat ctcgctgacc       360
     tatttcgagt tcaccacgct ggccatcctg cgcctgttcg cgcaatcgcg cctggacgcc       420
     gtggtgctgg aagtcggcct gggcggccgg ctggacgccg tcaatatcgt cgacgccgac       480
     tgttccatca tcaccagcat cgacctggac cataccgact ggctgggcga tacccgcgag       540
     aagatcggct tcgagaaggc gcacatctac cgcgcggggc gtcccgccat atgcgccgat       600
     ccggtgccgc cgcaatcgct gctggaccac gtgcaggcga tcggcgccga cctgtggctg       660
     ctcggccgcg actacaacta ttccggggac cgccagcaat gggcctacgg cgggcgggcg       720
     cagcggcgca acgcgctcgc ctatcccgca ttgcgcggcg ccaaccagct gctcaacgcg       780
     gccgccgcgc tggccgcgct cgaagccgtg cgcgaccgcc tgccggtgcc gcagcaggcg       840
     gtgcgggtgg ggctgctgca ggcgtcgctg ccgggccgct tccagatcct gcccgggcag       900
     ccgaccgtca tcctggacgt ggcgcacaat ccccatgccg ccgcggtcct ggcccagaac       960
     ctcgacaaca tggggttcca tccctatacg cacgccgtat tcggcatgct ggccgacaag      1020
     aacgtcgatg gcgtcatcgc caggctgggc agccgggtcg accactggta ctgcgccggc      1080
     ctgccgggcc cgcgcgggct ggatgggcag gccctggccg atcatgtgcg ccaggtgctg      1140
     cccgaggcgg aaggcgccgc cgaaacgcct accgtgcagg cctgcgccga ccccgccgcg      1200
     gcctatgcgg cggcgcggga aaaggcgggc gagggtgata gaatcatcgt gttcgggtca      1260
     tttctcacgg tggcctccgt cctgcaggcg ctgggccgca aaatctaa                   1308
//

If you have problems or comments...

PBIL Back to PBIL home page