(data stored in ACNUC1104 zone)

EMBL: BX640427.FOLD

BX640427.FOLD        Location/Qualifiers
FT   CDS_pept        complement(168195..169046)
FT                   /transl_table=11
FT                   /gene="folD"
FT                   /gene_synonym="ads"
FT                   /locus_tag="BPP1459"
FT                   /product="FolD bifunctional protein [includes:
FT                   methylenetetrahydrofolate dehydrogenase and
FT                   methylenetetrahydrofolate cyclohydrolase]"
FT                   /EC_number="1.5.1.5"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0990"
FT                   /db_xref="GOA:Q7WAC0"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WAC0"
FT                   /protein_id="CAE36761.1"
FT                   /translation="MTARIIDGAALSQRIREEVAQRVQALTAKGVRPGLAVVLVGDDPA
FT                   SQVYVRNKVAACEKAGLHSVKEQYPADLTEAQLLERIDALNRDPSIHGILVQLPLPRHM
FT                   DAHKVIEAIAAEKDVDGFHISNAGLLMTGQPLFRPCTPYGVMKMLESEGVALRGAEAVI
FT                   VGASNIVGKPMAMLLLQAGATITICNSKTRDLGAQTRRADVLVVATGKPGMIDGSMIKP
FT                   GAVVIDVGINRGADGKLCGDVDMASAREVAGAISPVPGGVGPMTIAMLLVNTVEAAERA
FT                   AA"
     atgaccgcac gcatcatcga cggcgccgcc ctgtcgcagc gcattcgcga agaagtcgcc        60
     cagcgcgtgc aggcgctgac ggccaagggc gtgcgccccg gcctggcggt cgtgctggtg       120
     ggcgacgacc ccgcctcgca agtctatgtg cgcaacaagg tcgccgcctg cgagaaggcc       180
     ggcctgcatt cggtcaagga gcaatacccg gccgacctca ccgaggccca gttgctcgaa       240
     cgcatcgacg cgctcaaccg cgacccgtcc atccacggca tcctggtgca gctgccgctg       300
     cccaggcaca tggacgcgca caaggtgatc gaggccattg ccgccgagaa ggacgtcgac       360
     ggtttccaca tcagcaatgc cggcctgctc atgaccggcc agccgctgtt tcgcccctgc       420
     acgccctacg gcgtgatgaa gatgctcgaa tccgaaggcg tggccctgcg cggcgccgag       480
     gcggtcatcg tgggcgccag caatatcgtc ggcaagccga tggcgatgct gctgctgcag       540
     gcgggcgcga ccatcaccat ctgcaactcc aagacccgcg acctgggcgc ccagacgcgc       600
     cgcgccgacg tgctggtggt ggccaccggc aagcccggca tgatcgacgg ctcgatgatc       660
     aagcccggcg ccgtggtcat cgacgtcggc atcaaccgcg gcgccgacgg caagttgtgc       720
     ggcgacgtcg acatggcctc ggcccgcgaa gtggccggcg ccatctcgcc ggtgcccggc       780
     ggcgtcggcc ccatgaccat cgccatgctg ctggtcaata cggttgaagc ggccgaacgc       840
     gctgccgcgt aa                                                           852
//

If you have problems or comments...

PBIL Back to PBIL home page