(data stored in ACNUC1104 zone)

EMBL: BX640427.GLNB

BX640427.GLNB        Location/Qualifiers
FT   CDS_pept        141758..142096
FT                   /transl_table=11
FT                   /gene="glnB"
FT                   /locus_tag="BPP1436"
FT                   /product="nitrogen regulatory protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2699"
FT                   /db_xref="GOA:Q7WAE1"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAE1"
FT                   /protein_id="CAE36738.1"
FT                   /translation="MKQVTAIIKPFKLDEVREALAEVGVSGLTVTEVKGFGRQKGHTEL
FT                   YRGAEYVVDFLPKIRVEVVLADDMVDPAIEAIVKAARTGKIGDGKIFVTPVEQAIRIRT
FT                   GESDEEAL"
     gtgaaacaag taaccgccat catcaaaccc ttcaagctgg acgaagtccg cgaagcgctg        60
     gccgaggtcg gcgtcagcgg cctgaccgtc accgaggtca aggggttcgg ccgccagaag       120
     ggccataccg agctgtatcg cggcgccgag tatgtggtgg atttcctgcc caagatccgc       180
     gtcgaggtcg tgctggccga cgacatggtc gatccggcca tcgaggccat cgtcaaggcc       240
     gcgcgcaccg gcaagatcgg cgacggcaag atcttcgtga ccccggtcga acaggccatc       300
     cgcatccgca ccggcgagag cgacgaagag gcgctgtag                              339
//

If you have problems or comments...

PBIL Back to PBIL home page